DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5390 and CG10764

DIOPT Version :9

Sequence 1:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_611213.2 Gene:CG10764 / 36962 FlyBaseID:FBgn0034221 Length:523 Species:Drosophila melanogaster


Alignment Length:297 Identity:76/297 - (25%)
Similarity:122/297 - (41%) Gaps:56/297 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   138 QNPNGVGF--KITGAVNQEAEFGEFPWMLAILREEGNLNLYECGGALIAPNVVLTAAHCVHNKQP 200
            :.|.|:..  ||:|. :..||.... ||.||.    |.:.::|||.:|....||:||||:  .:.
  Fly    27 ETPCGISTRPKISGG-DDAAEPNSI-WMAAIF----NSSDFQCGGTIIHMRFVLSAAHCL--VRG 83

  Fly   201 SSIVVRAGEWDTQTQTEIRRHEDRYVKEIIYHEQFNKGSLYNDVAVMLLESPFTLQENIQTVCL- 264
            ..:.||.|..:......:..     |..:..|..|......||:.::.|.........:|.:|: 
  Fly    84 YDLYVRLGARNINEPAAVHT-----VINVFVHHDFIASEYRNDIGLLQLSESIVYTVRVQPICIF 143

  Fly   265 --PNVGDKFDFDRCY-ATGWGKNKFGKDGEYQVILKKVDMPVVPEQQCETNLRETRLGRHFILHD 326
              |.:....:..:.: |.|||    .::|:..::|:.:.:..:...:|:..|       :|.|:.
  Fly   144 LDPALKGSVEKLKTFRALGWG----NRNGKLSIMLQTIYLLHLKRNECKRKL-------NFNLNS 197

  Fly   327 SFICAGGEKDKDTCKGDGGSPLVCPIAGQKNRFKSA--GIVAWG-IGCGEVNIPGVYASVAKLRP 388
            ..||| |.|:.|||:||.|.||...|....|:....  |||::| ..|..|   |||..|.....
  Fly   198 RQICA-GTKNGDTCRGDSGGPLSTNILFPSNKSYEVQLGIVSFGDPECRGV---GVYTDVTSYVD 258

  Fly   389 WIDAKLKIWSIDP-------------------RHYTP 406
            ||.:.:......|                   ||:||
  Fly   259 WISSTIARNDYLPIGVSGGDIAMGNPIAPDANRHWTP 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 65/244 (27%)
Tryp_SPc 153..390 CDD:214473 64/243 (26%)
CG10764NP_611213.2 Tryp_SPc 37..260 CDD:214473 67/250 (27%)
Tryp_SPc 38..263 CDD:238113 68/252 (27%)
Tryp_SPc 317..512 CDD:214473
Tryp_SPc 317..512 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.