DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5390 and CG8299

DIOPT Version :9

Sequence 1:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_611066.1 Gene:CG8299 / 36751 FlyBaseID:FBgn0034052 Length:260 Species:Drosophila melanogaster


Alignment Length:252 Identity:77/252 - (30%)
Similarity:127/252 - (50%) Gaps:33/252 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   154 EAEFGEFPWMLAILREEGNLNLYECGGALIAPNVVLTAAHCVHNKQPSSIVVRAGEWDTQTQTEI 218
            :|:..:||:.::: |.|..:.|:.|||::.||.||:|||||:..:..|.|.:.||      |..|
  Fly    33 QADIADFPYQVSV-RLETYMLLHICGGSIYAPRVVITAAHCIKGRYASYIRIVAG------QNSI 90

  Fly   219 RRHEDRYVK--EIIYHEQFNKGSLYNDVAVMLLESPFTLQENIQTVCL----PNVGDKFDFDRCY 277
            ...|::.||  ::|.|..:||.:..||:.:::...|......:|.:.:    |..|     .:..
  Fly    91 ADLEEQGVKVSKLIPHAGYNKKTYVNDIGLIITREPLEYSALVQPIAVALEAPPSG-----AQAV 150

  Fly   278 ATGWGKNKFGKDGE-YQVILKKVDMPVVPEQQCETNLRETRLGRHFILHDSFICAGG-EKDKDTC 340
            .:||||.  .:|.| ...:|:.|::.::.:..|....    |.:.:.:.|..:|||. |..||||
  Fly   151 VSGWGKR--AEDDEALPAMLRAVELQIIEKSTCGAQY----LTKDYTVTDEMLCAGYLEGGKDTC 209

  Fly   341 KGDGGSPLVCPIAGQKNRFKSAGIVAWGIGCGEVNIPGVYASVAKLRPWIDAKLKIW 397
            .||.|.||.  :.|     ...|:|:||:|||....||||.||.....||:.:.:.:
  Fly   210 NGDSGGPLA--VDG-----VLVGVVSWGVGCGREGFPGVYTSVNSHIDWIEEQAEAY 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 76/244 (31%)
Tryp_SPc 153..390 CDD:214473 75/243 (31%)
CG8299NP_611066.1 Tryp_SPc 27..252 CDD:214473 75/243 (31%)
Tryp_SPc 28..255 CDD:238113 77/246 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.