DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5390 and Prss56

DIOPT Version :9

Sequence 1:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster
Sequence 2:XP_003750778.1 Gene:Prss56 / 363274 RGDID:1563955 Length:607 Species:Rattus norvegicus


Alignment Length:300 Identity:83/300 - (27%)
Similarity:134/300 - (44%) Gaps:47/300 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 CDLPNKRKD--PIFEFKPDHPEGCGYQ-----NPNGVGFKITGAVNQEAEFGEFPWMLAILREEG 171
            |..|.:.:.  .:|:..|..|..||.:     |......:|.|  ...|..|.:||::.:  :.|
  Rat    72 CQGPGRPRPQASVFQDPPPEPGPCGERRQSVANTTRAHGRIVG--GSTAPLGAWPWLVRL--QLG 132

  Fly   172 NLNLYECGGALIAPNVVLTAAHC---VHNKQPSSIVVRAGEWDTQTQTEIRRHEDRYVKEIIYHE 233
            .|.|  |||.|:|.:.|||||||   ..|:...::::..|....|.       |:..|..|:.|.
  Rat   133 GLPL--CGGVLVAASWVLTAAHCFAGASNELLWTVMLAEGPQGEQA-------EEVQVNRILPHP 188

  Fly   234 QFNKGSLYNDVAVMLLESPFTLQENIQTVCLPN------VGDKFDFDRCYATGWGKNKFGKDGEY 292
            :|:..:.:||:|::.|.:|...:...:.:|||.      .|..     |...|||  ...:||..
  Rat   189 KFDPQTFHNDLALVQLWTPVNSEGPARPICLPEGSREPPAGTP-----CTIAGWG--ALFEDGPE 246

  Fly   293 QVILKKVDMPVVPEQQCETNLRETRLGRHFILHDSFICAG---GEKDKDTCKGDGGSPLVCPIAG 354
            ...:::..:|::....|:..|...      :...:.:|||   |  ..|:|:||.|.||.|...|
  Rat   247 SEAVREARVPLLSADTCQKALGPG------LSPSTMLCAGYLAG--GIDSCQGDSGGPLTCSEPG 303

  Fly   355 QKNRFKSAGIVAWGIGCGEVNIPGVYASVAKLRPWIDAKL 394
            .:.|....|:.:||.||||...||||..||..:.|:..::
  Rat   304 PRPREVLFGVTSWGDGCGEPGKPGVYTRVAVFKDWLQEQM 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 73/249 (29%)
Tryp_SPc 153..390 CDD:214473 72/248 (29%)
Prss56XP_003750778.1 Tryp_SPc 112..342 CDD:238113 75/257 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.