DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5390 and gammaTry

DIOPT Version :9

Sequence 1:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster


Alignment Length:255 Identity:72/255 - (28%)
Similarity:118/255 - (46%) Gaps:29/255 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 PNGVGFKITGAV--NQEAEFGEFPWMLAILREEGNLNLYECGGALIAPNVVLTAAHCVHNKQPSS 202
            |.|:..::.|.:  ........|||.:::.|.    ..:.|||::.:.||::|||||:.:...|.
  Fly    20 PEGLLPQLDGRIVGGSATTISSFPWQISLQRS----GSHSCGGSIYSSNVIVTAAHCLQSVSASV 80

  Fly   203 IVVRAGE--WDTQTQTEIRRHEDRYVKEIIYHEQFNKGSLYNDVAVMLLESPFTLQENIQTVCLP 265
            :.:|||.  |.:...|       ..|.....||.:|..::.||:|::.:....|....|:.:.|.
  Fly    81 LQIRAGSSYWSSGGVT-------FSVSSFKNHEGYNANTMVNDIAIIKINGALTFSSTIKAIGLA 138

  Fly   266 NVGDKFDFDRCYATGWGKNKFGKDGEYQVILKKVDMPVVPEQQCETNLRETRLGRHFILHDSFIC 330
            : .:..:......:|||...:| .......|:.|::.:|.:.||.:    :..|....:..:.||
  Fly   139 S-SNPANGAAASVSGWGTLSYG-SSSIPSQLQYVNVNIVSQSQCAS----STYGYGSQIRSTMIC 197

  Fly   331 AGGEKDKDTCKGDGGSPLVCPIAGQKNRFKSAGIVAWGIGCGEVNIPGVYASVAKLRPWI 390
            |.. ..||.|:||.|.|||       :.....|:|:||.||...|.|||||.||.||.|:
  Fly   198 AAA-SGKDACQGDSGGPLV-------SGGVLVGVVSWGYGCAYSNYPGVYADVAALRSWV 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 69/240 (29%)
Tryp_SPc 153..390 CDD:214473 68/238 (29%)
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 68/243 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.