DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5390 and CG13744

DIOPT Version :9

Sequence 1:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_610439.1 Gene:CG13744 / 35906 FlyBaseID:FBgn0033363 Length:389 Species:Drosophila melanogaster


Alignment Length:433 Identity:117/433 - (27%)
Similarity:171/433 - (39%) Gaps:96/433 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MILLNCLVICLCIFSCGAQDSSLDKLISDIFKTDETPKPSSPPPPVVNPKDSSGSTGSENGGSSS 65
            |.||..|.:||.:..|.:..|..:.|.:.:....|....|.     |.|...|.|...:.|..: 
  Fly     1 MQLLLWLCLCLLLLICQSSPSQANILNTLLGVPAECVHQSG-----VWPCKLSFSCWLQGGKHA- 59

  Fly    66 TQYQSCGDQKECVPRWL---CANDT---------------INTSGDGIIDIRLGTDAECKNYLDL 112
               :.||..|     ||   |..:|               .|....|.:.:.|.:          
  Fly    60 ---KGCGSNK-----WLFSCCVAETQHPHQQQHHSPSSPLANLVDYGKLKLNLNS---------- 106

  Fly   113 CCDLPN----KRKD--PIFEFKPDHPEGCGYQN--PNGVGFKITGAVNQEAEFGEFPWMLAILRE 169
               ||.    :|:|  .:...||:    ||...  .|.:..:|.|  .:.|:|.|:||...|...
  Fly   107 ---LPKRIMLRRRDDNELLNPKPE----CGVPRTAQNTLQKRIIG--GRPAQFAEYPWQAHIRIA 162

  Fly   170 EGNLNLYECGGALIAPNVVLTAAHCVHNKQPSSIVVRAGEWDTQTQTEIRRH---EDRYVKEIIY 231
            |     |:|||.||:.|:|.|||||:.....:.|.|..||.|||....|...   |...|.:.|.
  Fly   163 E-----YQCGGVLISANMVATAAHCIQQAHLADITVYLGELDTQDLGHIHEPLPVEKHGVLQKII 222

  Fly   232 HEQFN----KGSLYNDVAVMLLESPFTLQENIQTVCLPNVGDKFDFDRCYATGWGKNK--FGKDG 290
            |.:||    :...| |:|::.|..|.:..|:|..:|||....:....:....||||.:  .|..|
  Fly   223 HPRFNFRMTQPDRY-DIALLKLAQPTSFTEHILPICLPQYPIRLIGRKGLIAGWGKTEAHMGHAG 286

  Fly   291 EYQVILKKVDMPVVPEQQC-------ETNLRETRLGRHFILHDSFICAG-GEKDKDTCKGDGGSP 347
            ..  :|:...:|::....|       :.|:.         :.....||| .:...|.|.||.|.|
  Fly   287 TN--MLQVASVPIITTLDCIRWHESKQINVE---------IKAEMFCAGHSDGHMDACLGDSGGP 340

  Fly   348 LVCPIAGQKNRFKSAGIVAWGIGCGEVNIPGVYASVAKLRPWI 390
            ||..   ::.||...||.:.|.|||..:.||:|.:|.|...||
  Fly   341 LVIK---ERGRFVLVGITSAGFGCGVDHQPGIYHNVQKTVRWI 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 80/255 (31%)
Tryp_SPc 153..390 CDD:214473 78/253 (31%)
CG13744NP_610439.1 Tryp_SPc 141..380 CDD:214473 80/260 (31%)
Tryp_SPc 142..383 CDD:238113 82/261 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
21.910

Return to query results.
Submit another query.