DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5390 and flz

DIOPT Version :9

Sequence 1:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_001137622.1 Gene:flz / 35902 FlyBaseID:FBgn0286782 Length:1693 Species:Drosophila melanogaster


Alignment Length:376 Identity:111/376 - (29%)
Similarity:169/376 - (44%) Gaps:78/376 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 DKLISDIFKTDETPKPSSPPPPVVNPKDSSGSTGSENGGSSSTQYQSCGDQKECVPRWLCANDTI 88
            |:::.:..:.|..|.||.      |..| .|:|.|..||::..:..|                |.
  Fly  1380 DEIVDEEDEEDVNPNPSD------NEID-QGATLSSYGGANGRKIHS----------------TS 1421

  Fly    89 NTSGDGIIDIRLGTDAECKNYLDLCCDLPNKRKDPIFEFKPDHPEGCGYQNPNGVGFKITGAVNQ 153
            .|                         ||.    |...|.....| ||.: |:....:|.|  .:
  Fly  1422 RT-------------------------LPT----PNLAFHSPSTE-CGVR-PHVKSGRIVG--GK 1453

  Fly   154 EAEFGEFPWMLAILREEGNLNLY---ECGGALIAPNVVLTAAHCVHNKQP---SSIVVRAGEWDT 212
            .:.||.:||.: ::||...|.|:   :|||.||....|:|||||    ||   :|:|...||:|.
  Fly  1454 GSTFGAYPWQV-LVRESTWLGLFTKNKCGGVLITSRYVITAAHC----QPGFLASLVAVMGEFDI 1513

  Fly   213 QTQTEIRRHEDRYVKEIIYHEQFNKGSLYNDVAVMLLESPFTLQENIQTVCLPNVGDKFDFDRCY 277
            ....|.:|...:.||.:|.|.|::..:..||:|::.|:||.....:|..:|:||  |..||....
  Fly  1514 SGDLESKRSVTKNVKRVIVHRQYDPATFENDLALLELDSPVQFDTHIVPICMPN--DVADFTGRM 1576

  Fly   278 A--TGWGKNKFGKDGEYQVILKKVDMPVVPEQQCETNLRETRLGRHFILHDSFICAG-GEKDKDT 339
            |  ||||:.|:|  |....:|::|.:|::....|:......  |.:..:..||:||| ....||:
  Fly  1577 ATVTGWGRLKYG--GGVPSVLQEVQVPIIENSVCQEMFHTA--GHNKKILTSFLCAGYANGQKDS 1637

  Fly   340 CKGDGGSPLVCPIAGQKNRFKSAGIVAWGIGCGEVNIPGVYASVAKLRPWI 390
            |:||.|.|||  :.....|::.||.|:.||.|....:||||......:||:
  Fly  1638 CEGDSGGPLV--LQRPDGRYELAGTVSHGIKCAAPYLPGVYMRTTFYKPWL 1686

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 86/247 (35%)
Tryp_SPc 153..390 CDD:214473 85/245 (35%)
flzNP_001137622.1 PRK14948 <272..452 CDD:237862
PRK11633 <365..>439 CDD:236940
PRK10263 <547..>1005 CDD:236669
PHA03247 <792..1096 CDD:223021
Tryp_SPc 1449..1689 CDD:238113 88/253 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457476
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.