DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5390 and CG18563

DIOPT Version :9

Sequence 1:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_609841.2 Gene:CG18563 / 35050 FlyBaseID:FBgn0032639 Length:379 Species:Drosophila melanogaster


Alignment Length:378 Identity:121/378 - (32%)
Similarity:175/378 - (46%) Gaps:81/378 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 QSCGDQKECVPRWLCANDTINTSGDGIIDIRLGTDAECKNYLDLCCDL----------PNKRKD- 122
            ::|   :.|||...|.          |:..:|.:   |. :..:|||:          ||:..| 
  Fly    19 EAC---RYCVPMEKCL----------ILSRKLNS---CP-FNHVCCDIIIKSPYIPSGPNEESDS 66

  Fly   123 ------------PIFEFKPDHPEGCGYQNPNGVG-----------FKITGAVNQEAEFGEFP--- 161
                        |.|.:.|..|. ...:..|.|.           .|.:||...:....|.|   
  Fly    67 ESASSSTEEENIPTFIYFPTRPT-VSSEPQNNVSTEPDVPITYWPLKGSGAPTNDGAQAEQPKPT 130

  Fly   162 ----------------WMLAILREEGNLNLYECGGALIAPNVVLTAAHCVHNK-QPSSIVVRAGE 209
                            |::|:..||    :|..||:||:|.|:|||||...|| ....|||||||
  Fly   131 ERTQPGGRCNTTGLYSWVVALFYEE----VYLTGGSLISPKVILTAAHNTMNKMNEDRIVVRAGE 191

  Fly   210 WDTQTQTEIRRHEDRYVKEIIYHEQFNKGSLYNDVAVMLLESPFTLQENIQTVCLPNVGDKFDFD 274
            :...|..|..::|:|.|:.|:.||.|...|..|:||::.:::||.|.:.|..:.||:....|:..
  Fly   192 FVMNTTNEPIQYEERVVERIVRHEGFIFQSGINNVALIFVKTPFVLNDRIGVLTLPSRQASFEGR 256

  Fly   275 RCYATGWGKNKFGKDGEYQVILKKVDMPVVPEQQCETNLRETRLGRHFILHDSFICAGGEKDKDT 339
            ||...||.... ..|.....|:||:::.|:....|....|.|.|||:|.||.|.|||..|.::|.
  Fly   257 RCTVAGWDLVS-SHDQSRMRIIKKLELTVLDRTTCVAQFRNTTLGRNFDLHPSLICARSEINRDF 320

  Fly   340 CKGDGGSPLVCPIAGQKNR--FKSAGIVAWGIGCGEVNIPGVYASVAKLRPWI 390
            |.|.||..|.|.: |.:|.  |:.|||||||:||| :::||:|.:||..|.||
  Fly   321 CFGGGGYALFCSL-GDENPHVFEQAGIVAWGMGCG-LDLPGIYTNVAMFRSWI 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 98/260 (38%)
Tryp_SPc 153..390 CDD:214473 96/258 (37%)
CG18563NP_609841.2 Tryp_SPc 147..373 CDD:238113 96/232 (41%)
Tryp_SPc 147..371 CDD:214473 94/230 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457399
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BM7R
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003848
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.