DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5390 and CG9377

DIOPT Version :9

Sequence 1:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_609640.1 Gene:CG9377 / 34743 FlyBaseID:FBgn0032507 Length:355 Species:Drosophila melanogaster


Alignment Length:352 Identity:124/352 - (35%)
Similarity:187/352 - (53%) Gaps:41/352 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 CGDQKECVPRWLCANDTINTSGDGIID-IRLGTDAECKNYLDLCCDLPNKRKDPIFEFKPDHPE- 133
            ||.:|.|||...| |:.:...|....| .|...|..| :|::.||::|:|...|..      || 
  Fly    25 CGPEKHCVPYEQC-NEGLMVDGKFYPDRSRTTLDENC-HYMEKCCNIPDKLPTPKI------PEE 81

  Fly   134 ----GCG-------YQNPNGVGFKITGAVNQEAEFGEFPWMLAILREEGNLNLYECGGALIAPNV 187
                .||       |..|  :|:|     .|||:||||||::|:...:    .|.|.||||.|..
  Fly    82 MMSCPCGGRHDLWYYLRP--LGYK-----QQEAKFGEFPWLVAVYGSD----TYLCSGALITPLA 135

  Fly   188 VLTAAHCVHNKQPSSIVVRAGEWDTQTQTEIRRHEDRYVKEIIYHEQFNKGSLYNDVAVMLL--E 250
            |:|.||||.|.:...:.:.|||||...:.|.:.|:.|.|.|.:.|..:.:..|.:::|::|:  |
  Fly   136 VITTAHCVQNSEMEKVRLLAGEWDAAVELEPQPHQQRSVVETLVHPNYTQMPLAHNIAILLVDKE 200

  Fly   251 SPFTLQENIQTVCLPNVGDKFDFDRCYATGWGKNKFGKDGEYQVILKKVDMPVVPEQQCETNLRE 315
            .||.|..|:|.:|||.....:::.:||.:||.::.||:..   ::.|:..:.|:|..||.|.||.
  Fly   201 KPFQLAPNVQPICLPPPRIMYNYSQCYVSGWQRSDFGRAA---ILPKRWTLYVLPPDQCRTKLRL 262

  Fly   316 TRLGRHFILHDSFICAGGEKDKDTCKGD---GGSPLVCPIAGQKNRFKSAGIVAWGIGCGEVNIP 377
            :.|||....:||.:||||:|....| ||   ...||:||::|..:||..||::.....|....:.
  Fly   263 SLLGRRHAHNDSLLCAGGDKGDFVC-GDVDMTAVPLMCPLSGHDDRFHLAGLLTRTARCDGPQLL 326

  Fly   378 GVYASVAKLRPWIDAKLKIWSIDPRHY 404
            |:|.:|...|.|||.||:..::|.|||
  Fly   327 GIYTNVKLYRQWIDLKLRERNLDIRHY 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 89/242 (37%)
Tryp_SPc 153..390 CDD:214473 88/241 (37%)
CG9377NP_609640.1 Tryp_SPc 105..340 CDD:238113 89/242 (37%)
Tryp_SPc 105..339 CDD:214473 88/241 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BM7R
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 132 1.000 Inparanoid score I4490
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D382647at33208
OrthoFinder 1 1.000 - - FOG0003848
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.870

Return to query results.
Submit another query.