DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5390 and l(2)k05911

DIOPT Version :9

Sequence 1:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_723797.3 Gene:l(2)k05911 / 34731 FlyBaseID:FBgn0284244 Length:639 Species:Drosophila melanogaster


Alignment Length:369 Identity:109/369 - (29%)
Similarity:163/369 - (44%) Gaps:79/369 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 TPKPSSPPPPVVNPKDSSGSTGSENGGSSSTQYQSCGDQKECVPRWLCANDTINTSGDGIIDIRL 100
            ||:|:||..|....:.:..|..|....:::|:....|...|.:|                     
  Fly   341 TPRPTSPARPTTTRRPTYPSYPSPVTTTTTTRRPVSGTSSEGLP--------------------- 384

  Fly   101 GTDAECKNYLDLCCDLPNKRKDPIFEFKPDHPEGCGYQNPNGVGFKITGAVNQEAEFGEFPWMLA 165
               .:|.|            |:|:   .||..             :|.|.:|  |...|||| :|
  Fly   385 ---LQCGN------------KNPV---TPDQE-------------RIVGGIN--ASPHEFPW-IA 415

  Fly   166 ILREEGNLNLYECGGALIAPNVVLTAAHCVHNK---QPSSIVVRAGEWDTQTQTEIRRHEDRYVK 227
            :|.:.|.   ..|||:||..:.:|||||||...   ..:::....|:::..|..|: :|..|.:|
  Fly   416 VLFKSGK---QFCGGSLITNSHILTAAHCVARMTSWDVAALTAHLGDYNIGTDFEV-QHVSRRIK 476

  Fly   228 EIIYHEQFNKGSLYNDVAVMLLESPFTLQENIQTVCLPNVGDKFDFDRCYA------TGWGKNKF 286
            .::.|:.|...:|:||||::.|..|......||.:|||.  ......|.|:      .|||..: 
  Fly   477 RLVRHKGFEFSTLHNDVAILTLSEPVPFTREIQPICLPT--SPSQQSRSYSGQVATVAGWGSLR- 538

  Fly   287 GKDGEYQVILKKVDMPVVPEQQCETNLRETRLGRHFILHDSFICAGGEKDKDTCKGDGGSPLVCP 351
             ::|....||:|||:|:....:|.........|.   :.:|.||| |:..||:|.||.|.|:|..
  Fly   539 -ENGPQPSILQKVDIPIWTNAECARKYGRAAPGG---IIESMICA-GQAAKDSCSGDSGGPMVIN 598

  Fly   352 IAGQKNRFKSAGIVAWGIGCGEVNIPGVYASVAKLRPWIDAKLK 395
            ..|   |:...|||:||||||:...||||..|..|.|||...:|
  Fly   599 DGG---RYTQVGIVSWGIGCGKGQYPGVYTRVTSLLPWIYKNIK 639

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 86/246 (35%)
Tryp_SPc 153..390 CDD:214473 85/245 (35%)
l(2)k05911NP_723797.3 CLIP 111..174 CDD:197829
Tryp_SPc 399..634 CDD:214473 88/252 (35%)
Tryp_SPc 400..637 CDD:238113 90/254 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
33.010

Return to query results.
Submit another query.