DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5390 and OVCH1

DIOPT Version :9

Sequence 1:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster
Sequence 2:XP_024304736.1 Gene:OVCH1 / 341350 HGNCID:23080 Length:1120 Species:Homo sapiens


Alignment Length:461 Identity:125/461 - (27%)
Similarity:186/461 - (40%) Gaps:111/461 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 KLISDIFKTDETPKPSSPPPPVVNPKDSSGS-------------TGS---------ENGGSSSTQ 67
            |:...|..:....:.|....|.|:..:.|||             .||         |.|.:.|.:
Human   406 KVCGKILPSPLLAETSEAMVPFVSDTEDSGSGFELTVTAVQKSEAGSGCGSLAILVEEGTNHSAK 470

  Fly    68 YQS------------CGDQKECV------------PRWLCANDTINTSGD-----------GIID 97
            |..            |..:|..:            |.  |..|.:...||           |::.
Human   471 YPDLYPSNTRCHWFICAPEKHIIKLTFEDFAVKFSPN--CIYDAVVIYGDSEEKHKLAKLCGMLT 533

  Fly    98 IR----------LGTDAECKNYLD--------LCCDLPNK-------RKDPIFEFKPDHPEGCGY 137
            |.          :...::.||.|.        |..:..||       :.:|:...|....:.||.
Human   534 ITSIFSSSNMTVIYFKSDGKNRLQGFKARFTILPSESLNKFEPKLPPQNNPVSTVKAILHDVCGI 598

  Fly   138 Q--NPNGVGFKITGAVNQEAEFGEFPWMLAILREEGNLNLYECGGALIAPNVVLTAAHCVHNK-Q 199
            .  :|..:..:|.|  .:||....:||.:. ||..|:   |:||||:|.|..:|||||||..| .
Human   599 PPFSPQWLSRRIAG--GEEACPHCWPWQVG-LRFLGD---YQCGGAIINPVWILTAAHCVQLKNN 657

  Fly   200 PSSIVVRAGEWD---TQTQTEIRRHEDRYVKEIIYHEQFNKGSLYNDVAVMLLESPFTLQENIQT 261
            |.|..:.||:.|   .::..::||     .|.||.||.||..|..:|:|::.|.||......::.
Human   658 PLSWTIIAGDHDRNLKESTEQVRR-----AKHIIVHEDFNTLSYDSDIALIQLSSPLEYNSVVRP 717

  Fly   262 VCLPNVGDK-FDFDRCYATGWGKNKFGKDGEYQVILKKVDMPVVPEQQCETNLRETRLGRHFILH 325
            ||||:..:. |..:.|..||||  ....||.....|:::.:.|:..:.||........|.   :.
Human   718 VCLPHSAEPLFSSEICAVTGWG--SISADGGLASRLQQIQVHVLEREVCEHTYYSAHPGG---IT 777

  Fly   326 DSFICAG--GEKDKDTCKGDGGSPLVCPIAGQKNRFKSAGIVAWGIGCGEVNIPGVYASVAKLRP 388
            :..||||  ...:||.|:||.|.||||  ..:...|...|||:||.||.:...|||:|.|.....
Human   778 EKMICAGFAASGEKDFCQGDSGGPLVC--RHENGPFVLYGIVSWGAGCVQPWKPGVFARVMIFLD 840

  Fly   389 WIDAKL 394
            ||.:|:
Human   841 WIQSKI 846

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 87/244 (36%)
Tryp_SPc 153..390 CDD:214473 86/243 (35%)
OVCH1XP_024304736.1 Tryp_SPc 58..294 CDD:238113
CUB 336..444 CDD:238001 8/37 (22%)
CUB 454..565 CDD:238001 16/112 (14%)
Tryp_SPc 610..845 CDD:238113 90/252 (36%)
CUB 881..978 CDD:238001
CUB 1017..1119 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.