DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5390 and OVCH2

DIOPT Version :9

Sequence 1:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster
Sequence 2:XP_016873148.1 Gene:OVCH2 / 341277 HGNCID:29970 Length:569 Species:Homo sapiens


Alignment Length:262 Identity:72/262 - (27%)
Similarity:139/262 - (53%) Gaps:35/262 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 KITGAVNQEAEFGEFPWMLAILREEGNLNLYECGGALIAPNVVLTAAHCVHNKQ-PSSIVVRAGE 209
            :|.|  ..:.|.|.:||.:::.:.:.::    |||::::|..|:|||||:.|:. .|::.|.|||
Human    55 RILG--GSQVEKGSYPWQVSLKQRQKHI----CGGSIVSPQWVITAAHCIANRNIVSTLNVTAGE 113

  Fly   210 WDTQTQTEIRRHEDRYVKEIIYHEQFN-KGSLYNDVAVMLLESPFTLQENIQTVCLPNVGDKFDF 273
            :|. :||: ...:...::.:|.|..|: |..:..|:|::.:...|.....:..:|||.:.::|:.
Human   114 YDL-SQTD-PGEQTLTIETVIIHPHFSTKKPMDYDIALLKMAGAFQFGHFVGPICLPELREQFEA 176

  Fly   274 D-RCYATGWGKNKFGKDGEYQVILKKVDMPVVPEQQCET---NLRETRLGRHFILHDSFICAG-G 333
            . .|...|||:...|  |....:|::|::|::..::|..   .|:....|:      :|:|.| .
Human   177 GFICTTAGWGRLTEG--GVLSQVLQEVNLPILTWEECVAALLTLKRPISGK------TFLCTGFP 233

  Fly   334 EKDKDTCKGDGGSPLVCPIAGQKNRFKSAGIVAWGIGCG----------EVNIPGVYASVAKLRP 388
            :..:|.|:||.|..|:|  ..:|..:..||:.:||:|||          :...||::..::|:.|
Human   234 DGGRDACQGDSGGSLMC--RNKKGAWTLAGVTSWGLGCGRGWRNNVRKSDQGSPGIFTDISKVLP 296

  Fly   389 WI 390
            ||
Human   297 WI 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 70/255 (27%)
Tryp_SPc 153..390 CDD:214473 68/253 (27%)
OVCH2XP_016873148.1 Tryp_SPc 55..298 CDD:214473 70/260 (27%)
Tryp_SPc 56..301 CDD:238113 72/261 (28%)
CUB 320..424 CDD:238001
CUB 435..546 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.