DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5390 and CG31954

DIOPT Version :9

Sequence 1:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_722915.1 Gene:CG31954 / 33572 FlyBaseID:FBgn0051954 Length:277 Species:Drosophila melanogaster


Alignment Length:253 Identity:75/253 - (29%)
Similarity:126/253 - (49%) Gaps:44/253 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   161 PWMLAILREEG------NLNLYE-------------CGGALIAPNVVLTAAHCVHNKQPSSIVVR 206
            ||.|: .|.:|      .:|:.:             |||::|:...:||||||.:.|....:.||
  Fly    40 PWKLS-PRLDGRIVGGHRINITDAPHQVSLQTSSHICGGSIISEEWILTAAHCTYGKTADRLKVR 103

  Fly   207 AGEWDTQTQTEIRRHEDRYVKEIIYHEQFNKGSLYNDVAVMLLESPFTLQENIQTVCLPNVGDKF 271
            .|..:.....::.|     |::|:.|.|||..::..|.:::.|..|....|..:.|.||....|:
  Fly   104 LGTSEFARSGQLLR-----VQKIVQHAQFNYTNVDYDFSLLQLAHPIKFDETKKAVKLPESQMKY 163

  Fly   272 -DFDRCYATGWG--KNKFGKDGEYQVILKKVDMPVVPEQQCETNLRETRLGRHFILHDSFICAGG 333
             |.:.|:.:|||  :|..    |.:..|::|::|:|.::.|....::     :..:.:..||||.
  Fly   164 MDGEACFVSGWGNTQNLL----ESREWLRQVEVPLVNQELCSEKYKQ-----YGGVTERMICAGF 219

  Fly   334 -EKDKDTCKGDGGSPLVCPIAGQKNRFKSAGIVAWGIGCGEVNIPGVYASVAKLRPWI 390
             |..||.|:||.|.|:|.. :|:     ..|:|:||.||.:.:.||||:.|:..|.||
  Fly   220 LEGGKDACQGDSGGPMVSE-SGE-----LVGVVSWGYGCAKPDYPGVYSRVSFARDWI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 75/253 (30%)
Tryp_SPc 153..390 CDD:214473 73/251 (29%)
CG31954NP_722915.1 Tryp_SPc 50..271 CDD:214473 68/240 (28%)
Tryp_SPc 51..274 CDD:238113 70/241 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.