DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5390 and CG11911

DIOPT Version :9

Sequence 1:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_608518.1 Gene:CG11911 / 33206 FlyBaseID:FBgn0031249 Length:277 Species:Drosophila melanogaster


Alignment Length:258 Identity:71/258 - (27%)
Similarity:117/258 - (45%) Gaps:37/258 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 GFKITGAVNQEAEFGEFPWMLAI----LREEGNLNLYECGGALIAPNVVLTAAHCVHNKQPSSIV 204
            ||.|.|.   |||....|:::::    |:..     :.|||.||..:.::|||||:  .:|..:.
  Fly    35 GFVINGT---EAEPHSAPYIVSLATNYLKHS-----HICGGTLINKDWIVTAAHCI--SEPVGMS 89

  Fly   205 VRAGEWDTQTQTEI-RRHEDRYVKEIIYHEQFNKGSLYNDVAVMLLESPFTLQENIQTVCLPNVG 268
            :.||   ..|:.|: ...:.|.|.....||::..|....|:|::.:...|...|.:|...||: .
  Fly    90 IIAG---LHTRAEVDELTQQRQVDFGRVHEKYTGGVGPYDIALLHVNESFIFNEWVQPATLPS-R 150

  Fly   269 DKFDFDRCYATGWGKNKFGKDGEY----QVILKKVDMPVVPEQQCETNLRETRLGRHFILHDSFI 329
            ::......:..|||:.|     .|    ...|:.|...::..::|:..|.|:.     .:.:|.|
  Fly   151 EQVHEGETHLYGWGQPK-----SYIFSGAKTLQTVTTQILNYEECKEELPESA-----PIAESNI 205

  Fly   330 CAGG-EKDKDTCKGDGGSPLVCPIAGQKNRFKSAGIVAWG-IGCGEVNIPGVYASVAKLRPWI 390
            |:.. ::.|..|.||.|.|||.......:..  .|||:|| |.||..|:|.:|..|:....||
  Fly   206 CSSSLQQSKSACNGDSGGPLVVEFTNAPSEL--IGIVSWGYIPCGLANMPSIYTKVSAYIDWI 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 67/249 (27%)
Tryp_SPc 153..390 CDD:214473 65/247 (26%)
CG11911NP_608518.1 Tryp_SPc 37..269 CDD:238113 69/256 (27%)
Tryp_SPc 37..266 CDD:214473 67/254 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.