DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5390 and CG14227

DIOPT Version :9

Sequence 1:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_608345.2 Gene:CG14227 / 32978 FlyBaseID:FBgn0031058 Length:286 Species:Drosophila melanogaster


Alignment Length:277 Identity:64/277 - (23%)
Similarity:108/277 - (38%) Gaps:38/277 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 CGYQNPNGVGFKITGAVNQEAEFGEFPWMLAILREEGNLNLYECGGALIAPNVVLTAAHCVHNKQ 199
            ||...|...........:...:....||::::: ..|..   :|.|:||....||||||||..: 
  Fly    31 CGRSLPTNAKLTWWNYFDSSTDIQANPWIVSVI-VNGKA---KCSGSLINHRFVLTAAHCVFRE- 90

  Fly   200 PSSIVVRAGEWDT----QTQTEIRRHEDRYVKEI---IYHEQFNK--GSLYNDVAVMLLESPFTL 255
              ::.|..|::|.    |..:...|..:.|...|   |.|..|.|  ...| |:.::.::.....
  Fly    91 --AMQVHLGDFDAWNPGQNCSSGARLSNAYCVRIDKKIVHAGFGKIQAQQY-DIGLLRMQHAVQY 152

  Fly   256 QENIQTVCLPNVGDKFDFDRCYATGWGKNKFGKDGEYQVILKKVDMPV---VPEQQCETNLRETR 317
            .:.::.:||.........||...|.||...    .:::.|.:.:...|   :..:.|....::. 
  Fly   153 SDFVRPICLLINEPVAAIDRFQLTVWGTTA----EDFRSIPRVLKHSVGDRIDRELCTLKFQQQ- 212

  Fly   318 LGRHFILHDSFICAGGEKDKDTCKGDGGSPLVCPIA-GQKNRFKSAGIVAWGI-GCGEVNIPGVY 380
                  :.:|.||...| ....||||.|.|....|. |...|....||:.:|: .|..::   |.
  Fly   213 ------VDESQICVHTE-TSHACKGDSGGPFSAKILYGGTYRTFQFGIIIFGLSSCAGLS---VC 267

  Fly   381 ASVAKLRPWI-DAKLKI 396
            .:|.....|| ||.:.:
  Fly   268 TNVTFYMDWIWDALVNL 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 59/252 (23%)
Tryp_SPc 153..390 CDD:214473 57/250 (23%)
CG14227NP_608345.2 Tryp_SPc 57..277 CDD:214473 57/242 (24%)
Tryp_SPc 57..277 CDD:238113 57/242 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.