DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5390 and AgaP_AGAP012870

DIOPT Version :9

Sequence 1:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster
Sequence 2:XP_561168.5 Gene:AgaP_AGAP012870 / 3292575 VectorBaseID:AGAP012870 Length:225 Species:Anopheles gambiae


Alignment Length:196 Identity:52/196 - (26%)
Similarity:70/196 - (35%) Gaps:73/196 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 TDETPKPSSPPPPVVNPKDSSGSTGSENGGSSSTQYQSCGDQKECVPRWLCANDTI---NTSGDG 94
            |...|..:...|.:||       ||:..|       |:|    .|||...| |.|.   .|.|.|
Mosquito    62 TGVVPLQTGILPNIVN-------TGTPTG-------QTC----VCVPTGRC-NTTSTGGTTDGAG 107

  Fly    95 IIDIR------------LGT--------------------DAECKNYLDLCCDLPNKRKDPIFEF 127
            .:|:|            |||                    .|.|::.|:.||...:.:       
Mosquito   108 QLDVRIVSNPSANTGVTLGTTTTTTTTNTVASVIALNIASPATCQSGLERCCLAGSYQ------- 165

  Fly   128 KPDHPEGCGYQNPNGVGFKITGAVNQEAEFGEFPWMLAILREEGNLNLYECGGALIAPNVVLTAA 192
                   ||.|.|.........|  .:|.:||:||.:.:|   |..::|...||||....|||||
Mosquito   166 -------CGMQYPPIANSPAVTA--NQASYGEYPWQVVLL---GPGDVYVGSGALIDNLHVLTAA 218

  Fly   193 H 193
            |
Mosquito   219 H 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 18/41 (44%)
Tryp_SPc 153..390 CDD:214473 18/41 (44%)
AgaP_AGAP012870XP_561168.5 Tryp_SPc 182..>219 CDD:304450 16/39 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D23222at50557
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.