Sequence 1: | NP_001285802.1 | Gene: | CG5390 / 34383 | FlyBaseID: | FBgn0032213 | Length: | 406 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_561168.5 | Gene: | AgaP_AGAP012870 / 3292575 | VectorBaseID: | AGAP012870 | Length: | 225 | Species: | Anopheles gambiae |
Alignment Length: | 196 | Identity: | 52/196 - (26%) |
---|---|---|---|
Similarity: | 70/196 - (35%) | Gaps: | 73/196 - (37%) |
- Green bases have known domain annotations that are detailed below.
Fly 33 TDETPKPSSPPPPVVNPKDSSGSTGSENGGSSSTQYQSCGDQKECVPRWLCANDTI---NTSGDG 94
Fly 95 IIDIR------------LGT--------------------DAECKNYLDLCCDLPNKRKDPIFEF 127
Fly 128 KPDHPEGCGYQNPNGVGFKITGAVNQEAEFGEFPWMLAILREEGNLNLYECGGALIAPNVVLTAA 192
Fly 193 H 193 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG5390 | NP_001285802.1 | Tryp_SPc | 153..391 | CDD:238113 | 18/41 (44%) |
Tryp_SPc | 153..390 | CDD:214473 | 18/41 (44%) | ||
AgaP_AGAP012870 | XP_561168.5 | Tryp_SPc | 182..>219 | CDD:304450 | 16/39 (41%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D23222at50557 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.920 |