DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5390 and AgaP_AGAP011917

DIOPT Version :9

Sequence 1:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster
Sequence 2:XP_552323.2 Gene:AgaP_AGAP011917 / 3291454 VectorBaseID:AGAP011917 Length:246 Species:Anopheles gambiae


Alignment Length:254 Identity:66/254 - (25%)
Similarity:114/254 - (44%) Gaps:34/254 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 PNGVGFKITGAVNQEAEFGEFPWMLAILREEGNLNLYECGGALIAPNVVLTAAHCVHNKQPSSIV 204
            |||   :|.|.:  :|..|:.|||:::   ..::|.:.|||.|::...||::|:|:..:..::.:
Mosquito    20 PNG---RIVGGI--DAVAGDAPWMVSL---RNSINQHLCGGTLLSNRFVLSSANCLSGRLATATM 76

  Fly   205 VRAGEWDTQTQTEIRRHEDRYVKEIIYHEQFNKGSLYNDVAVMLLESPFTLQENIQTVCLPNVGD 269
            ..||.....|..     ...|..:||.|..||..:|.:|||:......|.|.:::|.  ||...|
Mosquito    77 AVAGSRFLNTAA-----IPYYGIQIITHPNFNVNTLEHDVALFQTALQFILTQSVQP--LPLSAD 134

  Fly   270 KFDFD-RCYATGWGKNKFGKDGEYQVILKKVDMPVVPEQQCETNL--RETRLGRHFILHDSFICA 331
            ..... |....|||.::  .:|.....|:.:::..:....|...|  ...|:|      .|.:|.
Mosquito   135 VIGVGVRARVFGWGASQ--ANGGNTNALQFLNVNTLSNDDCANFLGAEGWRIG------PSSLCT 191

  Fly   332 GGEKDKDTCKGDGGSPLVCPIAGQKNRFKSAGIVAWGIGCGEVNIPGVYASVAKLRPWI 390
            ...:.:..|.||.|..||.      :.: :.|:.:|||.|. ...|.|:..::.:|.||
Mosquito   192 LTREGQGICGGDEGGALVL------DNY-AIGVASWGIPCA-TGRPDVFVRISAVRSWI 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 61/241 (25%)
Tryp_SPc 153..390 CDD:214473 59/239 (25%)
AgaP_AGAP011917XP_552323.2 Tryp_SPc 23..242 CDD:214473 61/246 (25%)
Tryp_SPc 24..242 CDD:238113 61/245 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.