DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5390 and Prss34

DIOPT Version :9

Sequence 1:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_848459.1 Gene:Prss34 / 328780 MGIID:2681414 Length:318 Species:Mus musculus


Alignment Length:278 Identity:91/278 - (32%)
Similarity:129/278 - (46%) Gaps:56/278 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 GVGFKITGAVNQ-EAEFGEFPWMLAILREEGNLNLY---------ECGGALIAPNVVLTAAHCVH 196
            |.|..:.|.|.. ......|||.:       :|.||         ||||:||.|..||||||||.
Mouse    27 GSGQGLVGIVGGCPVSASRFPWQV-------SLRLYDMEHSRWEHECGGSLIHPQWVLTAAHCVR 84

  Fly   197 NKQPSSIVVRAGEWDTQTQTEIRRHE-DRYVK--EIIYHEQFN-----KGSLYNDVAVMLLESPF 253
            .|:..:..||.      ...::|.:| |:.:|  :||.|.:|:     :|..  |:|::.|::..
Mouse    85 PKEVEAYGVRV------QVGQLRLYENDQLMKVVKIIRHPKFSEKLSARGGA--DIALLKLDTRV 141

  Fly   254 TLQENIQTVCLPNVGDKFDFDR-CYATGWG--KNKFGKDGEYQVILKKVDMPVVPEQQCE----T 311
            .|.|::..|.||....:....: |:..|||  :|.......|.  |::|.:|:|....||    |
Mouse   142 VLSEHVYPVSLPAASLRISSKKTCWVAGWGVIENYMPLPPPYH--LREVAVPIVENNDCEQKYQT 204

  Fly   312 NLRETRLGRHFILHDSFICAGGEKDKDTCKGDGGSPLVCPIAGQKNRFK----SAGIVAWGIGCG 372
            |.......|  |:.|..:|||.| .:|:||.|.|.||||       |:.    ..|:|:||||||
Mouse   205 NSSSDSTTR--IIKDDMLCAGKE-GRDSCKADSGGPLVC-------RWNCSWVQVGVVSWGIGCG 259

  Fly   373 EVNIPGVYASVAKLRPWI 390
            ..:.||||..|.....||
Mouse   260 LPDFPGVYTRVMSYVSWI 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 87/267 (33%)
Tryp_SPc 153..390 CDD:214473 85/265 (32%)
Prss34NP_848459.1 Tryp_SPc 35..278 CDD:238113 88/270 (33%)
Tryp_SPc 35..277 CDD:214473 86/268 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.