DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5390 and CG9673

DIOPT Version :9

Sequence 1:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_001285346.1 Gene:CG9673 / 32649 FlyBaseID:FBgn0030775 Length:261 Species:Drosophila melanogaster


Alignment Length:279 Identity:67/279 - (24%)
Similarity:114/279 - (40%) Gaps:57/279 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 GVGFKITGAV-------------NQEAEFGEFPWMLAILREEGNLNLYECGGALIAPNVVLTAAH 193
            |:|..|.|.:             .::...||:||..::...:.::    |.||:|:.|.:|||||
  Fly     9 GLGLLIFGLILSAEASPQGRILGGEDVAQGEYPWSASVRYNKAHV----CSGAIISTNHILTAAH 69

  Fly   194 CVHN-----KQPSSIVVRAGEWDTQTQTEIRRHEDRYVKEIIYHEQFNKGSLYNDVAVMLLESPF 253
            ||.:     ...|::.||.|..:......|..     ||.:|.|..:  |:..:|:|::.|:...
  Fly    70 CVSSVGITPVDASTLAVRLGTINQYAGGSIVN-----VKSVIIHPSY--GNFLHDIAILELDETL 127

  Fly   254 TLQENIQTVCLPNVGDK--FDFDR-------CYATGWGKNKFGKDGEYQVILKKVDMPVVPEQQC 309
            ...:.||.:.||...|:  .|.|.       .|..|||:.   .||......:|.:...:....|
  Fly   128 VFSDRIQDIALPPTTDEETEDVDAELPNGTPVYVAGWGEL---SDGTASYKQQKANYNTLSRSLC 189

  Fly   310 ETNLRETRLGRHFILHDSFICAGGEKDKDTCKGDGGSPLVCPIAGQKNRFKSAGIVAWGIG-CGE 373
            |.   |...|     ::|.:|....:.:..|:||.|:.::      .:.....|:.::..| ||.
  Fly   190 EW---EAGYG-----YESVVCLSRAEGEGICRGDAGAAVI------DDDKVLRGLTSFNFGPCGS 240

  Fly   374 VNIPGVYASVAKLRPWIDA 392
             ..|.|...|:....||:|
  Fly   241 -KYPDVATRVSYYLTWIEA 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 61/252 (24%)
Tryp_SPc 153..390 CDD:214473 60/251 (24%)
CG9673NP_001285346.1 Tryp_SPc 28..256 CDD:214473 60/256 (23%)
Tryp_SPc 29..259 CDD:238113 63/259 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.