DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5390 and CG33160

DIOPT Version :9

Sequence 1:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_788456.1 Gene:CG33160 / 326265 FlyBaseID:FBgn0053160 Length:258 Species:Drosophila melanogaster


Alignment Length:271 Identity:77/271 - (28%)
Similarity:116/271 - (42%) Gaps:57/271 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 HPEGCGYQNPNGVGFKITGAVNQEAEFGEFPWMLAILREEGNLNLYECGGALIAPNVVLTAAHCV 195
            ||:....| |..:|..:: ::.:|      .:::.:...|     ..|||:|:.|..|:||||||
  Fly    24 HPDSVQIQ-PRIIGGHVS-SIKEE------KYLVQVTTSE-----ELCGGSLVKPRWVITAAHCV 75

  Fly   196 HNKQPSSIVVRAGEWDTQTQTEIRRHEDRYVKEIIYHEQFNKGSLYNDVAVMLLESPFTLQENIQ 260
            :||..:...:..|..:......:.|..|    .|.....||:.:|..|||.:.|.|.. :..||:
  Fly    76 YNKNKNDFKIYGGASNQAGPYAVIRTVD----YIAIRPDFNRKTLNMDVAALRLNSDM-IGANIE 135

  Fly   261 TV----------CLPNVGDKFDFDRCYATGWG--KNKFGKDGEYQVILKKVDMPVVPEQQCETNL 313
            |:          .|..|           :|||  .....|..|.   :..|.:|:.....|.:..
  Fly   136 TIPLAAQSVPARALVKV-----------SGWGFLTADATKTAER---VHSVLVPMWSRASCVSAF 186

  Fly   314 RETRLGRHFILHDSFICAGGEKDKDTCKGDGGSPLVCPIAGQKNRFKSAGIVAWGIGCGEVNIPG 378
            |    |.|.|.. |.:||.....||:|.||.|.|||       .|.:.||||::|.||... :||
  Fly   187 R----GIHRITR-SMVCAARLYKKDSCDGDSGGPLV-------YRGQLAGIVSFGYGCASA-LPG 238

  Fly   379 VYASVAKLRPW 389
            :|.||.::|.|
  Fly   239 IYTSVPEIRDW 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 72/249 (29%)
Tryp_SPc 153..390 CDD:214473 72/249 (29%)
CG33160NP_788456.1 Tryp_SPc 33..249 CDD:214473 72/259 (28%)
Tryp_SPc 34..253 CDD:238113 73/260 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.