DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5390 and prss59.1

DIOPT Version :9

Sequence 1:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_955899.2 Gene:prss59.1 / 322453 ZFINID:ZDB-GENE-030131-1173 Length:242 Species:Danio rerio


Alignment Length:256 Identity:76/256 - (29%)
Similarity:122/256 - (47%) Gaps:51/256 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 KITGAVNQEAEFGEFPWMLAILREEGNLNLYECGGALIAPNVVLTAAHCVHNKQPSSIVVRAGEW 210
            ||.|  ..|.:....||..::     |...:.|||:|::...|::||||    ..|.:.||.||.
Zfish    20 KIVG--GYECQPNSQPWQASL-----NSGYHFCGGSLVSEYWVVSAAHC----YKSRVEVRLGEH 73

  Fly   211 DTQTQTEIRRHEDRYV--KEIIYHEQFNKGSLYNDVAVMLLESPFTLQENIQTVCLPNVGDKFDF 273
            :    ..|....::::  :::|.:..::...|.:|:.::.|..|.||.:.:|.|.||| |...|.
Zfish    74 N----IVINEGTEQFITSEKVIRNPNYDSWDLDSDIMLIKLSKPATLNKYVQPVALPN-GCAADG 133

  Fly   274 DRCYATGWG--------KNKFGKDGEYQVILKKVDMPVVPEQQCETNLRETRLGRHFILHDSFIC 330
            ..|..:|||        .||          |:.:::|::.::.|..:...       ::.|:..|
Zfish   134 TMCRVSGWGNTMSSTADSNK----------LQCLEIPILSDRDCNNSYPG-------MITDTMFC 181

  Fly   331 AGG-EKDKDTCKGDGGSPLVCPIAGQKNRFKSAGIVAWGIGCGEVNIPGVYASVAKLRPWI 390
            ||. |..||:|:||.|.|:||  .|:.:     |||:||.||.|.|.||||..|.....||
Zfish   182 AGYLEGGKDSCQGDSGGPVVC--NGELH-----GIVSWGYGCAEKNHPGVYGKVCMFSQWI 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 73/249 (29%)
Tryp_SPc 153..390 CDD:214473 71/247 (29%)
prss59.1NP_955899.2 Tryp_SPc 20..235 CDD:214473 74/254 (29%)
Tryp_SPc 21..238 CDD:238113 75/255 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.