DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5390 and CG32523

DIOPT Version :9

Sequence 1:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster


Alignment Length:271 Identity:75/271 - (27%)
Similarity:113/271 - (41%) Gaps:54/271 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   138 QNPNGVGFKITGAVNQEAEFGEFPWMLAI-LREEGNLNLYECGGALIAPNVVLTAAHCVHNKQPS 201
            |:.:.:..:|.|.:  :|:.|:||..::: ||.|     :.|||.:|:...|:||.|||.:   .
  Fly    28 QSESAIEPRIVGGI--KAKQGQFPHQISLRLRGE-----HYCGGVIISATHVITAGHCVKH---G 82

  Fly   202 SIVVRAGEWDTQTQTEIRRHEDRY--VKEIIYHEQFNKGSLYNDVAVMLLESPFTLQENIQTVCL 264
            :.||.|..|..|..:.:...:...  |.|:|.|..:..|. :||:||:.|:||.|...||..:.|
  Fly    83 NDVVPADLWSIQAGSLLLSSDGVRIPVAEVIMHPNYATGG-HNDLAVLRLQSPLTFDANIAAIQL 146

  Fly   265 -----PNVGDKFDFDRCYA---TGWGKNKFGKDGEYQVILKKVDMPVVPEQQCE----TNLRETR 317
                 ||         |.|   :|||  ...:.|.....|..|.:..:....|.    :.|.|| 
  Fly   147 ATEDPPN---------CVAVDISGWG--NIAEKGPLSDSLLFVQVTSISRGACRWMFYSRLPET- 199

  Fly   318 LGRHFILHDSFICAGGEKDKDTCKGDGGSPLVCPIAGQKNRFKSAGIVAWGIGCGEVNIPGVYAS 382
                      .||....|:...|.||.|.|     |....:......:..|.|||.. .|..|..
  Fly   200 ----------MICLLHSKNSGACYGDSGGP-----ATYGGKVVGLASLLLGGGCGRA-APDGYLR 248

  Fly   383 VAKLRPWIDAK 393
            ::|:|.||..|
  Fly   249 ISKVRAWIAEK 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 70/252 (28%)
Tryp_SPc 153..390 CDD:214473 69/251 (27%)
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 71/258 (28%)
Tryp_SPc 37..219 CDD:238113 61/214 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457443
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.