DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5390 and Prss40

DIOPT Version :9

Sequence 1:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_001101679.1 Gene:Prss40 / 316318 RGDID:1561330 Length:376 Species:Rattus norvegicus


Alignment Length:307 Identity:81/307 - (26%)
Similarity:122/307 - (39%) Gaps:69/307 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 CGYQNPNGVGFKITGAVNQEAEFGEFPWMLAILREEGNLNLYE---CGGALIAPNVVLTAAHCVH 196
            ||.....|   ||.|  .|.|....:||       :.:|.||.   ||..||..|.|.:||||..
  Rat    62 CGKTQFQG---KIYG--GQIAGAQRWPW-------QASLRLYGRHICGAVLIDKNWVASAAHCFQ 114

  Fly   197 -NKQPSSIVVRAGEWDTQTQTEIRRHEDRYVKEIIYHEQFNK----GSLYNDVAVMLLESPFTLQ 256
             ::.|....:..|.  |:..:..|......||::|.|:.:||    ||   |:.::.|.|.....
  Rat   115 MSRNPGDYQIMLGY--TKLNSPTRYSRKMSVKKLIVHKDYNKFYPQGS---DIVLLQLHSSVEYS 174

  Fly   257 ENIQTVCLPNVGDKFDFDR-CYATGWGKNKFGKD---------GEYQVILKKVD------MPVVP 305
            .:|...|:||.......:: |:.:|||..:  :|         .|.::|:...|      .|.||
  Rat   175 SHILPACVPNKNITIPKEKACWTSGWGNLR--EDVRLPLPNDLYEAELIIMSNDDCKGFFPPPVP 237

  Fly   306 EQQCETNLRETRLGRHFILHDSFICAGG-EKDKDTCKGDGGSPLVCPIAGQKNRFKSAGIVAWGI 369
            ..           .:.:.::|..:||.. ...|..|.||.|.||||.:.|.   :...|:.:|..
  Rat   238 GS-----------SKTYYIYDDMVCAADYSLTKSICSGDSGGPLVCLLEGS---WYVVGLTSWSS 288

  Fly   370 GCGE-VNIPGVYASVAKLRPWIDAKLKIWSID---------PRHYTP 406
            .|.: ::.|.|:|.|:....||....|. |.|         |.|..|
  Rat   289 SCEDPISSPSVFARVSYFDKWISDNKKA-SGDSKPGESYRPPHHQRP 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 68/263 (26%)
Tryp_SPc 153..390 CDD:214473 67/262 (26%)
Prss40NP_001101679.1 Tryp_SPc 70..310 CDD:214473 70/269 (26%)
Tryp_SPc 71..313 CDD:238113 71/271 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.