DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5390 and CG6041

DIOPT Version :9

Sequence 1:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_572281.1 Gene:CG6041 / 31527 FlyBaseID:FBgn0029826 Length:308 Species:Drosophila melanogaster


Alignment Length:276 Identity:75/276 - (27%)
Similarity:112/276 - (40%) Gaps:62/276 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 EGCGYQNPNGVGFKITGAVNQEAEFGEFPWMLAILREEGNLNLYECGGALIAPNVVLTAAHCVHN 197
            |...||    |..::|  .|.:..:|           .|:|    |||.:|:..:|.|||||.:.
  Fly    44 EQVSYQ----VSIRLT--ANDKKSYG-----------SGHL----CGGVVISQRLVATAAHCCYI 87

  Fly   198 KQPSSIVVRAGEWD-TQTQTEIRRHEDR----YVKEIIYHEQFNKGSLYNDVAVMLLES--PF-- 253
            ........ |||:. ....|.:....||    |::::|.||.:|..:|.||:|:|.:..  |:  
  Fly    88 TDKKKYRT-AGEFVLVMGSTYLTSSTDRTLMYYLQQLITHENYNPDALTNDIALMFINGYIPWNW 151

  Fly   254 ----TLQENIQTVCLPNVGDKFDFDRCYATGWGKNKFGKDGEYQV-ILKKVDMPVVPEQQCETNL 313
                .|..|.|.|....        .|..:|||  ...::|.:.. .|:...:|:|....|..:.
  Fly   152 PTVTALALNSQLVATNT--------DCLISGWG--LLQQNGTFSSNTLQAATVPIVSYTTCRISY 206

  Fly   314 RETRLGRHFILHDSFICAGG-EKDKDTCKGDGGSPLVCPIAGQKNRFKSAGIVAWGIGCGEVNIP 377
            ....:        |.:|||. ....|.|:||.|.|:.|       ....||||::|.||.....|
  Fly   207 NSIPV--------SQVCAGYLSGGVDACQGDSGGPMSC-------NGMLAGIVSYGAGCAAPGYP 256

  Fly   378 GVYASVAKLRPWIDAK 393
            |||.:|:....||..|
  Fly   257 GVYTNVSYYYDWIVQK 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 67/252 (27%)
Tryp_SPc 153..390 CDD:214473 66/251 (26%)
CG6041NP_572281.1 Tryp_SPc 34..269 CDD:214473 72/271 (27%)
Tryp_SPc 35..272 CDD:238113 74/274 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.