DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5390 and Tmprss9

DIOPT Version :9

Sequence 1:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_001382445.1 Gene:Tmprss9 / 314636 RGDID:1309581 Length:1095 Species:Rattus norvegicus


Alignment Length:273 Identity:86/273 - (31%)
Similarity:133/273 - (48%) Gaps:25/273 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 PEGCGYQNPNGVGFKITGAVNQEAEFGEFPWMLAILREEGNLNLYECGGALIAPNVVLTAAHCVH 196
            |:.||.:.......:|.|.::  |..||.||..::  :||:.:.  ||..::....:|:||||.:
  Rat   525 PQECGARPAMDKPTRIVGGIS--AVSGEVPWQASL--KEGSRHF--CGATVVGDRWLLSAAHCFN 583

  Fly   197 NKQPSSIVVRAGEWDTQTQTEIRRHEDRY-VKEIIYHEQFNKGSLYNDVAVMLLESPFTLQENIQ 260
            :.:...:....|   |.:...:.....:. ::.:..|.::|.|.|..|||::.|..|....:.||
  Rat   584 HTKLEQVQAHLG---TVSLLGVGGSPVKLGLRSVALHPRYNPGILDFDVALLELAQPLVFNKYIQ 645

  Fly   261 TVCLPNVGDKFDFDR-CYATGWGKNKFGKDGEYQVILKKVDMPVVPEQQCETNLRETRLGRHFIL 324
            .||||....||...| |..:|||..:.| :.....||:|..:.::.::.|....       :|.|
  Rat   646 PVCLPLAIHKFPVGRKCMISGWGNMQEG-NATKPDILQKASVGIIEQKMCGALY-------NFSL 702

  Fly   325 HDSFICAGG-EKDKDTCKGDGGSPLVCPIAGQKNRFKSAGIVAWGIGCGEVNIPGVYASVAKLRP 388
            .|..:|||. |...|:|:||.|.||.|  ......|..||||:|||||.:...|||||.:.:|:.
  Rat   703 TDRMLCAGFLEGRVDSCQGDSGGPLAC--EETPGVFYLAGIVSWGIGCAQAKKPGVYARITRLKD 765

  Fly   389 WIDAKLKIWSIDP 401
            ||   ||..|.||
  Rat   766 WI---LKAMSSDP 775

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 75/240 (31%)
Tryp_SPc 153..390 CDD:214473 74/239 (31%)
Tmprss9NP_001382445.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.