DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5390 and CG3795

DIOPT Version :9

Sequence 1:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_001284790.1 Gene:CG3795 / 31128 FlyBaseID:FBgn0025378 Length:305 Species:Drosophila melanogaster


Alignment Length:321 Identity:75/321 - (23%)
Similarity:127/321 - (39%) Gaps:97/321 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 PNKRKDPIFEFKPDHPEGCGYQNPNGVGFKITGAVNQEAE-----------------FGEFPWML 164
            |::|:|                .|:...|.:||....:..                 ||:     
  Fly    32 PSQRQD----------------RPSDFQFLVTGGYRPDTNDLVKYTVSLRMGKPKKFFGD----- 75

  Fly   165 AILREEGNLNLYECGGALIAPNVVLTAAHCVHNK----QPSSIVVRAGEWDTQTQTEIRRHEDRY 225
                     |.: |.|.:.:...:||||||:.:.    :...::|.||     |...:.:.....
  Fly    76 ---------NHF-CAGTIFSERAILTAAHCMFSNRRKLKAKKLMVVAG-----TPRRLLKSSTTQ 125

  Fly   226 V---KEIIYHEQFNKG-SLYNDVAVMLLESPFTLQENIQTVCL----PNVGDKFDFDRCYATGWG 282
            :   :|::.|.::.|| |...|:.::|||:..:|.:.:..:.|    |..|..     |...|||
  Fly   126 IIEAEELLPHPKYKKGKSQKYDIGLILLEADLSLGDAVAKIPLYNKVPVAGAP-----CSIVGWG 185

  Fly   283 K-NKFGKDGEYQVILKKVDMPVVPEQQCETNLRETRLGRHFILHDSFICAGG--EKDKDTCKGDG 344
            . .:||...:..:   ..||.::|:..||..|..:..|        .:||..  :.|.|:|:||.
  Fly   186 TVIQFGPLPDEAI---NGDMQILPDTFCEKLLGWSNAG--------MLCANDKHDSDVDSCQGDS 239

  Fly   345 GSPLVCPIAGQKNRFKSAGIVAWGIGCGEVNIPGVYASVAKLRPWID------AKLKIWSI 399
            |.||:|     .|..  .|||::|:||||.:..|:|..|...|.||.      ....:|::
  Fly   240 GGPLIC-----DNMV--TGIVSFGMGCGEPDSAGIYTDVYHFRDWITENSCPLGTRSVWTL 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 66/269 (25%)
Tryp_SPc 153..390 CDD:214473 65/268 (24%)
CG3795NP_001284790.1 Tryp_SPc 60..281 CDD:238113 67/263 (25%)
Tryp_SPc 60..278 CDD:214473 65/260 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.