DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5390 and Tpsg1

DIOPT Version :9

Sequence 1:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_783183.1 Gene:Tpsg1 / 302990 RGDID:631355 Length:311 Species:Rattus norvegicus


Alignment Length:262 Identity:83/262 - (31%)
Similarity:122/262 - (46%) Gaps:26/262 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 GCGYQNPNGVGFKITGAVNQEAEFGEFPWMLAILREEGNLNLYECGGALIAPNVVLTAAHCVHNK 198
            |||....:..|.:|.|  ...|:.|.:||..::..::    ::.|||:|::|..|||||||....
  Rat    17 GCGQPQVSHAGSRIVG--GHAAQAGAWPWQASLRLQK----VHVCGGSLLSPEWVLTAAHCFSGS 75

  Fly   199 QPSS-IVVRAGEWDTQTQTEIRRHEDRYVKEII-YHEQFNKGSLYNDVAVMLLESPFTLQENIQT 261
            ..|| ..|..||...........     ||:|| |...........|:|::.|.:|..|...:|.
  Rat    76 VNSSDYEVHLGELTITLSPHFST-----VKQIIMYSSAPGPPGSSGDIALVQLATPVALSSQVQP 135

  Fly   262 VCLPNVGDKFDFD---RCYATGWGKNKFGKDGEYQVILKKVDMPVVPEQQCETNLRETRLGRHFI 323
            ||||..  ..||.   :|:.||||..:.|:..:....|::..:.||..:.|......:   ...:
  Rat   136 VCLPEA--SADFHPGMQCWVTGWGYTQEGEPLKPPYNLQEAKVSVVDVETCSQAYSSS---NGSL 195

  Fly   324 LHDSFICAGGEKDKDTCKGDGGSPLVCPIAGQKNRFKSAGIVAWGIGCGEVNIPGVYASVAKLRP 388
            :....:||.|  ..|.|:.|.|.||||.:||   .::.||:|:||.|||..:.|||||.|.....
  Rat   196 IQSDMLCAWG--PGDACQDDSGGPLVCRVAG---IWQQAGVVSWGEGCGRPDRPGVYARVTAYVN 255

  Fly   389 WI 390
            ||
  Rat   256 WI 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 77/243 (32%)
Tryp_SPc 153..390 CDD:214473 75/241 (31%)
Tpsg1NP_783183.1 Tryp_SPc 29..257 CDD:214473 77/248 (31%)
Tryp_SPc 30..260 CDD:238113 79/249 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346320
Domainoid 1 1.000 162 1.000 Domainoid score I3893
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.