DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5390 and Prss22

DIOPT Version :9

Sequence 1:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_001100454.1 Gene:Prss22 / 302971 RGDID:1310880 Length:307 Species:Rattus norvegicus


Alignment Length:267 Identity:78/267 - (29%)
Similarity:130/267 - (48%) Gaps:25/267 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 PDHPEGCGYQNPNGVGFKITGAVNQEAEFGEFPWMLAILREEGNLNLYECGGALIAPNVVLTAAH 193
            ||    ||  .|..:...:.|..:.:|   ::||:::||:.    ..:.|.|:|:....|::|||
  Rat    39 PD----CG--KPQQLNRVVGGEDSADA---QWPWIVSILKN----GSHHCAGSLLTNRWVVSAAH 90

  Fly   194 CVHNK--QPSSIVVRAGEWDTQTQTEIRRHEDRYVKEIIYHEQFN-KGSLYNDVAVMLLESPFTL 255
            |..:.  :||...|..|.|.......  |.:...:..::.|.::: |...:.|:|::.||.|...
  Rat    91 CFSSNMDKPSPYSVLLGAWKLGNPGP--RSQKVGIASVLPHPRYSRKEGTHADIALVRLERPIQF 153

  Fly   256 QENIQTVCLPNVGDKFDFD-RCYATGWGKNKFGKDGEYQVILKKVDMPVVPEQQCETNLRETRLG 319
            .|.|..:|||:.......: .|:..|||..:.|........|:|:.:|::..:.|: :|.....|
  Rat   154 SERILPICLPDSSVHLPPNTNCWIAGWGSIQDGVPLPRPQTLQKLKVPIIDPELCK-SLYWRGAG 217

  Fly   320 RHFILHDSFICAGG-EKDKDTCKGDGGSPLVCPIAGQKNRFKSAGIVAWGIGCGEVNIPGVYASV 383
            :..|..| .:|||. |..:|.|.||.|.||:|.:   .:.:...||::||.||.|.|.||||.|:
  Rat   218 QEAITED-MLCAGYLEGKRDACLGDSGGPLMCQV---DDHWLLTGIISWGEGCAERNRPGVYTSL 278

  Fly   384 AKLRPWI 390
            ...|||:
  Rat   279 LAHRPWV 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 72/243 (30%)
Tryp_SPc 153..390 CDD:214473 71/241 (29%)
Prss22NP_001100454.1 Tryp_SPc 49..285 CDD:214473 72/249 (29%)
Tryp_SPc 50..288 CDD:238113 73/250 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 162 1.000 Domainoid score I3893
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.