DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5390 and Prss32

DIOPT Version :9

Sequence 1:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_001100453.1 Gene:Prss32 / 302970 RGDID:1311905 Length:334 Species:Rattus norvegicus


Alignment Length:283 Identity:91/283 - (32%)
Similarity:145/283 - (51%) Gaps:30/283 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 CGYQNPNGVGFKITGAVNQEAEFGEFPWMLAILREEGNLNLYECGGALIAPNVVLTAAHCVHNKQ 199
            ||  .|...|..::|   |.|:.|::||.::: ||:|   ::.|||:||:.:.|||||||.:..|
  Rat    45 CG--RPRASGRIVSG---QNAQLGQWPWQVSV-REDG---VHVCGGSLISEDWVLTAAHCFNQDQ 100

  Fly   200 P-SSIVVRAG---EWDTQTQTEIRRHEDRYVKEIIYH-EQFNKGSLYNDVAVMLLESPFTLQENI 259
            . |:..|..|   .:....:....|...:|:|...|. |:.:.|    |:|::.|.||.:..:.:
  Rat   101 HLSAYTVLLGTISSYPEDNEPRELRAVAQYIKYPSYSAEEHSSG----DIALLQLASPISFNDYM 161

  Fly   260 QTVCLPNVGDKFD-FDRCYATGWGKNKFGKDGEYQVILKKVDMPVVPEQQCETNLRETRL--GRH 321
            ..||||..||..| ...|:.||||.....:.......|:::.:|::..:.|.|..:|..:  ...
  Rat   162 LPVCLPKPGDPLDPGTMCWVTGWGNIATNQPLPPPFTLQELQVPLIDAKTCNTYYQENSVPSTEQ 226

  Fly   322 FILHDSFICAG-GEKDKDTCKGDGGSPLVCPIAGQKNRFKSAGIVAWGIGCGEVNIPGVYASVAK 385
            .||.| .:||| .|..||.|.||.|.||||.:   .:.:..||:|:||..|...|.||||.:|:.
  Rat   227 VILED-MLCAGFVEGKKDACNGDSGGPLVCDV---NDVWIQAGVVSWGSDCALSNRPGVYTNVSV 287

  Fly   386 LRPWIDAKLKIWSI--DPRHYTP 406
            ...||...:  |:|  :.::::|
  Rat   288 YISWIQNTM--WNIPTEGKNFSP 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 82/246 (33%)
Tryp_SPc 153..390 CDD:214473 81/245 (33%)
Prss32NP_001100453.1 Tryp_SPc 53..292 CDD:214473 82/253 (32%)
Tryp_SPc 54..295 CDD:238113 84/255 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 162 1.000 Domainoid score I3893
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8953
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.