DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5390 and GZMA

DIOPT Version :9

Sequence 1:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_006135.2 Gene:GZMA / 3001 HGNCID:4708 Length:262 Species:Homo sapiens


Alignment Length:265 Identity:67/265 - (25%)
Similarity:120/265 - (45%) Gaps:36/265 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 PNGVGFKITGAVNQEAEFGEFPWMLAILREEGNLNLYECGGALIAPNVVLTAAHCVHNKQPSSIV 204
            |..|..||.|  ..|......|:|:.:..:...:    |.|||||.:.|||||||..||: |.::
Human    22 PEDVCEKIIG--GNEVTPHSRPYMVLLSLDRKTI----CAGALIAKDWVLTAAHCNLNKR-SQVI 79

  Fly   205 VRAGEWDTQTQTEIRRHEDRYVKEIIYHEQFNKGSLYNDVAVMLLESPFTLQENIQTVCLPNVGD 269
            :.|.....:..|:    :...||:...:..::..:...|:.::.|.....:.:.:..:.||..||
Human    80 LGAHSITREEPTK----QIMLVKKEFPYPCYDPATREGDLKLLQLMEKAKINKYVTILHLPKKGD 140

  Fly   270 KF-DFDRCYATGWGKNKFGKDGEYQVILKKVDMPVVPEQQCETNLRETRLGRHF----ILHDSFI 329
            .. ....|...|||:..  ....:...|::|::.::..:.|...       .|:    ::..:.:
Human   141 DVKPGTMCQVAGWGRTH--NSASWSDTLREVNITIIDRKVCNDR-------NHYNFNPVIGMNMV 196

  Fly   330 CAGGEK-DKDTCKGDGGSPLVCPIAGQKNRFKSAGIVAWGI--GCGEVNIPGVYASVAKLR-PWI 390
            |||..: .:|:|.||.||||:|     :..|:  |:.::|:  .||:...||||..::|.. .||
Human   197 CAGSLRGGRDSCNGDSGSPLLC-----EGVFR--GVTSFGLENKCGDPRGPGVYILLSKKHLNWI 254

  Fly   391 DAKLK 395
            ...:|
Human   255 IMTIK 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 60/246 (24%)
Tryp_SPc 153..390 CDD:214473 59/245 (24%)
GZMANP_006135.2 Tryp_SPc 29..254 CDD:238113 61/251 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.