DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5390 and F11

DIOPT Version :9

Sequence 1:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster
Sequence 2:XP_006253206.1 Gene:F11 / 290757 RGDID:1309364 Length:622 Species:Rattus norvegicus


Alignment Length:239 Identity:87/239 - (36%)
Similarity:128/239 - (53%) Gaps:26/239 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   158 GEFPWMLAILREEGNLNLYECGGALIAPNVVLTAAHCVHNKQ-PSSIVVRAGEWDTQTQTEIRRH 221
            ||:||.:.:...:|:|    |||::|....:||||||....: |.::.|..|   ...|:||  :
  Rat   397 GEWPWQVTLHTTQGHL----CGGSIIGNRWILTAAHCFSGTETPKTLRVYGG---IVNQSEI--N 452

  Fly   222 EDR---YVKEIIYHEQFNKGSLYNDVAVMLLESPFTLQENIQTVCLPNVGDK-FDFDRCYATGWG 282
            ||.   .|:|:|.|:|:.......|:|::.||......:..:.:|||:.||: .....|:.||||
  Rat   453 EDTTFFRVQEMIIHDQYTSAESGFDIALLKLEPAMNYTDFQRPICLPSKGDRNVVHTECWVTGWG 517

  Fly   283 KNKFGKDGEYQVILKKVDMPVVPEQQCETNLRETRLGRHFILHDSFICAG-GEKDKDTCKGDGGS 346
            ..| .:| |.|..|:|..:|:|..::|:|..|:.:      :.:..|||| .|..|||||||.|.
  Rat   518 YTK-SRD-EVQSTLQKAKVPLVSNEECQTRYRKHK------ITNKVICAGYKEGGKDTCKGDSGG 574

  Fly   347 PLVCPIAGQKNRFKSAGIVAWGIGCGEVNIPGVYASVAKLRPWI 390
            ||.|...|.   :...||.:||.|||:...||||.:|||...||
  Rat   575 PLSCKHNGV---WHLVGITSWGEGCGQKERPGVYTNVAKYVDWI 615

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 87/239 (36%)
Tryp_SPc 153..390 CDD:214473 85/237 (36%)
F11XP_006253206.1 APPLE 20..103 CDD:128519
APPLE 110..193 CDD:128519
APPLE 200..283 CDD:128519
APPLE 291..374 CDD:128519
Tryp_SPc 387..615 CDD:214473 85/237 (36%)
Tryp_SPc 388..615 CDD:238113 85/237 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.