DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5390 and Prss34

DIOPT Version :9

Sequence 1:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_001099242.1 Gene:Prss34 / 287140 RGDID:1306667 Length:316 Species:Rattus norvegicus


Alignment Length:271 Identity:89/271 - (32%)
Similarity:133/271 - (49%) Gaps:43/271 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   160 FPWMLAILREEGNLNLYE--CGGALIAPNVVLTAAHCVHNK--QPSSIVVRAGEWDTQTQTEIRR 220
            |||.:::......|:.:|  |||:||.|..||||||||..|  :.|...|:.|        ::|.
  Rat    44 FPWQVSLRFYNMKLSKWEHICGGSLIHPQWVLTAAHCVELKEMEASCFRVQVG--------QLRL 100

  Fly   221 HE-DRYVK--EIIYHEQFNK------GSLYNDVAVMLLESPFTLQENIQTVCLPNVGDKFDFDRC 276
            :| |:.:|  :||.|.:|::      |:   |:|::.|:|...|.|.:..|.||....:....:.
  Rat   101 YENDQLMKVAKIIRHPKFSEKLSAPGGA---DIALLKLDSTVVLSERVHPVSLPAASQRISSKKT 162

  Fly   277 -YATGWGKNKFGKDGEYQVILKKVDMPVVPEQQCETNLRE-TRLGRHF-ILHDSFICAGGEKDKD 338
             :..|||..:..:.......|::|.:|:|....||...|. :.|.|.. |:.|..:|||.| .:|
  Rat   163 WWVAGWGVIEGHRPLPPPCHLREVAVPIVGNSDCEQKYRTYSSLDRTTKIIKDDMLCAGME-GRD 226

  Fly   339 TCKGDGGSPLVCPIAGQKNRFK----SAGIVAWGIGCGEVNIPGVYASVAKLRPWIDA---KLKI 396
            :|:.|.|.||||       |:.    ..|:|:||||||..:.||||..|.....||..   |...
  Rat   227 SCQADSGGPLVC-------RWNCSWVQVGVVSWGIGCGLPDFPGVYTRVMSYLSWIHGYVPKFPE 284

  Fly   397 WSIDP-RHYTP 406
            .|:.| |.:||
  Rat   285 PSMGPDRIHTP 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 82/250 (33%)
Tryp_SPc 153..390 CDD:214473 81/249 (33%)
Prss34NP_001099242.1 Tryp_SPc 33..276 CDD:238113 82/250 (33%)
Tryp_SPc 33..275 CDD:214473 81/249 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8953
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.