DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5390 and Prss27

DIOPT Version :9

Sequence 1:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_891994.3 Gene:Prss27 / 287108 RGDID:1303256 Length:328 Species:Rattus norvegicus


Alignment Length:290 Identity:95/290 - (32%)
Similarity:132/290 - (45%) Gaps:34/290 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 CGYQNPNGVGFKITGAVNQEAEFGEFPWMLAILREEGNLNLYECGGALIAPNVVLTAAHCVHNKQ 199
            ||:  |......:.|   ::|..||:||.::|.|...:.    |||:||||..|||||||..|..
  Rat    29 CGH--PRMFNRMVGG---EDALEGEWPWQVSIQRNGAHF----CGGSLIAPTWVLTAAHCFSNTS 84

  Fly   200 PSSIV-VRAGEWDTQTQTEIRRHEDRYVKEIIYHEQFNKGSLYNDVAVMLLESPFTLQENIQTVC 263
            ..||. |..|....|.......:..  ||.:..|.::...:...|||::.|:.|.|..:.|..||
  Rat    85 DISIYQVLLGALKLQQPGPHALYVP--VKRVKSHPEYQGMASSADVALVELQVPVTFTKYILPVC 147

  Fly   264 LPNVGDKFDFD-RCYATGWGKNKFGKDGEYQVILKKVDMPVVPEQQCETNLRETRLGRHFI---- 323
            ||:....|... .|:.||||............||:|:.:|::...:|  ||..::.....|    
  Rat   148 LPDPSVVFKSGMNCWVTGWGSPSEQDRLPNPRILQKLAVPLIDTPKC--NLLYSKDAEADIQLKT 210

  Fly   324 LHDSFICAG-GEKDKDTCKGDGGSPLVCPIAGQKNRFKSAGIVAWGIGCGEVNIPGVYASVAKLR 387
            :.|..:||| .|..||.||||.|.||||.:   ...:..||:::||.||...|.||||..||...
  Rat   211 IKDDMLCAGFAEGKKDACKGDSGGPLVCLV---DQSWVQAGVISWGEGCARRNRPGVYIRVASHY 272

  Fly   388 PWID-----------AKLKIWSIDPRHYTP 406
            .||.           |..:....|||.:.|
  Rat   273 QWIHQIIPELQFQGRAGSQQQQRDPRGWQP 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 85/244 (35%)
Tryp_SPc 153..390 CDD:214473 84/243 (35%)
Prss27NP_891994.3 Tryp_SPc 37..275 CDD:214473 85/251 (34%)
Tryp_SPc 39..278 CDD:238113 87/252 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 162 1.000 Domainoid score I3893
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.