DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5390 and Prss30

DIOPT Version :9

Sequence 1:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_955403.2 Gene:Prss30 / 287106 RGDID:735142 Length:304 Species:Rattus norvegicus


Alignment Length:269 Identity:88/269 - (32%)
Similarity:129/269 - (47%) Gaps:39/269 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 NGVGFKITGAVNQEAEFGEFPWMLAILRE-EGNLNLYECGGALIAPNVVLTAAHCVHNKQPSSIV 204
            :|.| ||.|  .|:|..|.:||.:::..| ||::    |||:||....|||||||......||..
  Rat    26 SGAG-KIVG--GQDAPEGRWPWQVSLRTEKEGHI----CGGSLIHEVWVLTAAHCFCRPLNSSFY 83

  Fly   205 -VRAGEWD---TQTQTEIRRHEDRYVKEIIYHEQFNKGSLYNDVAVMLLESPFTLQ-ENIQTVCL 264
             |:.|...   |:..:.:....:.:|......|..:.|    |:|::.|::|  || .....|||
  Rat    84 HVKVGGLTLSLTEPHSTLVAVRNIFVYPTYLWEDASSG----DIALLRLDTP--LQPSQFSPVCL 142

  Fly   265 PNV------GDKFDFDRCYATGWGKNKFGKDGEYQVILKKVDMPVVPEQQCET--NLRETRLGRH 321
            |..      |..     |:.||||..   .:.|...:|:::.:|::..:.||.  ::.||.|...
  Rat   143 PQAQAPLTPGTV-----CWVTGWGAT---HERELASVLQELAVPLLDSEDCERMYHIGETSLSGK 199

  Fly   322 FILHDSFICAG-GEKDKDTCKGDGGSPLVCPIAGQKNRFKSAGIVAWGIGCGEVNIPGVYASVAK 385
            .::....:||| .|..||:|:||.|.||||.|   .:.:...||.:|||||...|.||||..|..
  Rat   200 RVIQSDMLCAGFVEGQKDSCQGDSGGPLVCAI---NSSWIQVGITSWGIGCARPNKPGVYTRVPD 261

  Fly   386 LRPWIDAKL 394
            ...||...|
  Rat   262 YVDWIQRTL 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 81/252 (32%)
Tryp_SPc 153..390 CDD:214473 80/251 (32%)
Prss30NP_955403.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 162 1.000 Domainoid score I3893
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.