DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5390 and Gzmf

DIOPT Version :9

Sequence 1:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_703196.2 Gene:Gzmf / 266704 RGDID:628603 Length:248 Species:Rattus norvegicus


Alignment Length:246 Identity:67/246 - (27%)
Similarity:116/246 - (47%) Gaps:41/246 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   161 PWM--LAILREEGNLNLYECGGALIAPNVVLTAAHCVHNKQPSSIVVRAGEWDTQTQTEIRRHED 223
            |:|  :..::.:||.::  |||.|:....|||||||.....  .:::.|.....|.:|:    :.
  Rat    33 PYMAHVKFVKVDGNRSV--CGGFLVQDYFVLTAAHCTGRSM--KVILGAHNLHVQEKTQ----QI 89

  Fly   224 RYVKEIIYHEQFNKGSLYNDVAVMLLESPFTLQENIQTVCLPNVGDKF-DFDRCYATGWGK---- 283
            ..||..|.|..:|:....||:.::.|||.......::.:.||...|.. ..|.|...|||:    
  Rat    90 IPVKRAIPHPAYNREDHINDIMLLKLESKAKKTRAVRPLNLPRPNDMVKPGDVCRVAGWGQMSVD 154

  Fly   284 --NKFGKDGEYQVILKKVDMPVVPEQQCETNLRETRLGRHFILHDSFICAGG-EKDKDTCKGDGG 345
              .:..:..|.::|:::       :::|:      :|..|: ...:.||||. :|.:...|||.|
  Rat   155 VTKRTSRLQEAKLIIQE-------DKECK------KLFHHY-SETTEICAGDPKKIQAAYKGDSG 205

  Fly   346 SPLVCPIAGQKNRFKSAGIVAWGIGCGEVNIPGVYASVAKLRPWIDAKLKI 396
            .||||     :||  :.|:|::|.. |.:: .||:..|....|||...:|:
  Rat   206 GPLVC-----ENR--AYGVVSYGKN-GTIS-SGVFTKVVYFLPWISRNMKL 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 65/239 (27%)
Tryp_SPc 153..390 CDD:214473 64/238 (27%)
GzmfNP_703196.2 Tryp_SPc 21..244 CDD:238113 66/241 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.