DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5390 and Klk8

DIOPT Version :9

Sequence 1:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_001311327.1 Gene:Klk8 / 259277 MGIID:1343327 Length:260 Species:Mus musculus


Alignment Length:238 Identity:70/238 - (29%)
Similarity:108/238 - (45%) Gaps:38/238 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   161 PWMLAILREEGNLNLYECGGALIAPNVVLTAAHCVHNKQPSSIVVRAGEWDTQTQTEIRRHEDRY 225
            ||..|:.:.|..:    |||.|:....|||||||  .||..|  ||.|  |...|:..:..::..
Mouse    45 PWQAALFQGERLI----CGGVLVGDRWVLTAAHC--KKQKYS--VRLG--DHSLQSRDQPEQEIQ 99

  Fly   226 VKEIIYHEQFNKGS---LYNDVAVMLLESPFTLQENIQTVCL----PNVGDKFDFDRCYATGWGK 283
            |.:.|.|..:|..:   ..:|:.::.|::...|.:.::.|.|    |.||.|     |..:|||.
Mouse   100 VAQSIQHPCYNNSNPEDHSHDIMLIRLQNSANLGDKVKPVQLANLCPKVGQK-----CIISGWGT 159

  Fly   284 NKFGKDGEYQVILKKVDMPVVPEQQCETNLRETRLGRHFILHDSFICAGGEKDKDTCKGDGGSPL 348
            ....:: .:...|...::.:..:.:||    ....|:   :.:..:|||.....|||:||.|.||
Mouse   160 VTSPQE-NFPNTLNCAEVKIYSQNKCE----RAYPGK---ITEGMVCAGSSNGADTCQGDSGGPL 216

  Fly   349 VCPIAGQKNRFKSAGIVAWGIG-CGEVNIPGVYASVAKLRPWI 390
            ||....|       ||.:||.. ||:...||||..:.:...||
Mouse   217 VCDGMLQ-------GITSWGSDPCGKPEKPGVYTKICRYTTWI 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 70/238 (29%)
Tryp_SPc 153..390 CDD:214473 68/236 (29%)
Klk8NP_001311327.1 Tryp_SPc 32..252 CDD:214473 68/236 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.