DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5390 and TPSG1

DIOPT Version :9

Sequence 1:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster
Sequence 2:XP_011520748.1 Gene:TPSG1 / 25823 HGNCID:14134 Length:346 Species:Homo sapiens


Alignment Length:282 Identity:92/282 - (32%)
Similarity:122/282 - (43%) Gaps:46/282 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 GCGYQNPNGVGFKITGAVNQEAEFGEFPWMLAI-LREEGNLNLYECGGALIAPNVVLTAAHCVHN 197
            |||....:..|.:|.|  ...|..|.:||..:: ||     .::.|||:|::|..|||||||...
Human    50 GCGRPQVSDAGGRIVG--GHAAPAGAWPWQASLRLR-----RVHVCGGSLLSPQWVLTAAHCFSG 107

  Fly   198 KQPSS-IVVRAGEWDTQTQTEIRRHEDRYVKEIIYHEQ-FNKGSLYNDVAVMLLESPFTLQENIQ 260
            ...|| ..|..||.:.........     |::||.|.. ..:.....|:|::.|..|.||...|.
Human   108 SLNSSDYQVHLGELEITLSPHFST-----VRQIILHSSPSGQPGTSGDIALVELSVPVTLSSRIL 167

  Fly   261 TVCLPNVGDKF-DFDRCYATGWGKNKFGKDGEYQVILKKVDMPVVPEQQCETNLRETRLGRHF-- 322
            .||||...|.| ...||:.||||..:.|:.......|::|.:.||..:.|.         |.:  
Human   168 PVCLPEASDDFCPGIRCWVTGWGYTREGEPLPPPYSLREVKVSVVDTETCR---------RDYPG 223

  Fly   323 ----ILHDSFICAGGEKDKDTCKGDGGSPLVCPIAGQKNRFKSAGIVAWGIGCGEVNIPGVYASV 383
                ||....:||.|  ..|.|:.|.|.||||.:.|   .:..||.|:||.|||..|.||||..|
Human   224 PGGSILQPDMLCARG--PGDACQDDSGGPLVCQVNG---AWVQAGTVSWGEGCGRPNRPGVYTRV 283

  Fly   384 AKLRPWIDAKLKIWSIDPRHYT 405
            .....||          .||.|
Human   284 PAYVNWI----------RRHIT 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 82/247 (33%)
Tryp_SPc 153..390 CDD:214473 81/246 (33%)
TPSG1XP_011520748.1 Tryp_SPc 62..290 CDD:214473 83/253 (33%)
Tryp_SPc 63..293 CDD:238113 85/265 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152793
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.