DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5390 and Plau

DIOPT Version :9

Sequence 1:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_037217.3 Gene:Plau / 25619 RGDID:3343 Length:432 Species:Rattus norvegicus


Alignment Length:436 Identity:115/436 - (26%)
Similarity:178/436 - (40%) Gaps:97/436 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 SCGAQDSSL---DKLISDIFKTDETPKPSSPPPPVVNPKDSSGSTGSENGGSSSTQYQSCGDQKE 76
            :||.|:..:   .|..|.|.:.....|.......:...|......|....|.::|..:.    :.
  Rat    30 NCGCQNGGVCVSYKYFSSIRRCSCPKKFKGEHCEIDTSKTCYHGNGQSYRGKANTDTKG----RP 90

  Fly    77 CVPRW---LCANDTINTSGDGIIDIRLGTDAECKN-----------------YLDLC----CDLP 117
            |: .|   .....|.|......:.:.||....|:|                 ::..|    |.|.
  Rat    91 CL-AWNSPAVLQQTYNAHRSDALSLGLGKHNYCRNPDNQRRPWCYVQIGLKQFVQECMVQDCSLS 154

  Fly   118 NKRKDPIFEFKPDHPEG--CGYQ--NPNGVGFKITGAVNQEAEFGEF------PWMLAIL--REE 170
            .|....:.:      :|  ||.:  .|.   |||.|        |||      ||..||.  .:.
  Rat   155 KKPSSTVDQ------QGFQCGQKALRPR---FKIVG--------GEFTVVENQPWFAAIYLKNKG 202

  Fly   171 GNLNLYECGGALIAPNVVLTAAHC-VHNKQPSSIVVRAGEWDTQTQTEIRRHEDRY-VKEIIYHE 233
            |:...::|||:||:|..|.:|.|| |:..:....||..|:   ..:......|.:: |:::|.||
  Rat   203 GSPPSFKCGGSLISPCWVASATHCFVNQPKKEEYVVYLGQ---SKRNSYNPGEMKFEVEQLILHE 264

  Fly   234 QFNKGSL--YNDVAVMLLES-------PFTLQENIQTVCL-PNVGD-KFDFDRCYATGWGKNKFG 287
            .|:..:|  :||:|::.:.:       |   ...|||:|| |..|| .|..| |..||:|:.. .
  Rat   265 DFSDETLAFHNDIALLKIRTSTGQCAQP---SRTIQTICLPPRFGDAPFGSD-CEITGFGQES-A 324

  Fly   288 KDGEYQVILKKVDMPVVPEQQCETNLRETRLGRHFI---LHDSFICAGGEKDK-DTCKGDGGSPL 348
            .|..|...||...:.::..:||:.        .|:.   ::...:||...:.| |:|.||.|.||
  Rat   325 TDYFYPKDLKMSVVKIISHEQCKQ--------PHYYGSEINYKMLCAADPEWKTDSCSGDSGGPL 381

  Fly   349 VCPIAGQKNRFKSAGIVAWGIGCGEVNIPGVYASVAKLRPWIDAKL 394
            :|.|.|   |...:|||:||.||.|.|.||||..|:....||.:.:
  Rat   382 ICNIDG---RPTLSGIVSWGSGCAEKNKPGVYTRVSYFLNWIQSHI 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 83/262 (32%)
Tryp_SPc 153..390 CDD:214473 82/261 (31%)
PlauNP_037217.3 Binds urokinase plasminogen activator surface receptor 34..57 4/22 (18%)
KR 67..152 CDD:238056 13/89 (15%)
Connecting peptide 152..178 6/34 (18%)
Tryp_SPc 178..420 CDD:214473 85/268 (32%)
Tryp_SPc 179..423 CDD:238113 86/270 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.