DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5390 and CG30289

DIOPT Version :9

Sequence 1:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_726081.1 Gene:CG30289 / 246532 FlyBaseID:FBgn0050289 Length:316 Species:Drosophila melanogaster


Alignment Length:281 Identity:82/281 - (29%)
Similarity:125/281 - (44%) Gaps:52/281 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 EGCGYQN-----PNGVGFKITGAVNQEAEFGEFPWMLAILREEGNLNLYECGGALIAPNVVLTAA 192
            |.||...     ||..|    ||   :....|.|||:.:...:      .|||:|||...|||||
  Fly    28 ENCGISKDDPYVPNIFG----GA---KTNIQENPWMVLVWSSK------PCGGSLIARQFVLTAA 79

  Fly   193 HCVHNKQPSSIVVRAGEWDTQTQTE-------IRRHEDRYVKEIIYHEQFNKGSLYNDVAVMLLE 250
            |||..:   .:.||.|:::|.....       |.:..:..|...|.||.:|..:|.||:|::.:.
  Fly    80 HCVSFE---DLYVRLGDYETLDPMPYCLNNHCIPKFYNISVDMKIVHENYNGITLQNDIALLRMS 141

  Fly   251 SPFTLQENIQTVCLPNVGDKFDFDRCY-ATGWGKNKFGKDGEYQVILKKVDMPVVPEQQCETNLR 314
            ......:.::.:|| .||::......: .||||:.::   |::..||....:..:....|  |::
  Fly   142 EAVEYSDYVRPICL-LVGEQMQSIPMFTVTGWGETEY---GQFSRILLNATLYNMDISYC--NIK 200

  Fly   315 ETRLGRHFILHDSFICAGGEKDKDTCKGDGGSPLVCPIAGQK----NRFKS--AGIVAWGIGCGE 373
            ..:....     |.||||.. ..:|||||.|.||     ..|    ||..|  .|:|::|.....
  Fly   201 FNKQADR-----SQICAGSH-TSNTCKGDSGGPL-----SSKFHYGNRLLSFQYGLVSYGSERCA 254

  Fly   374 VNIPGVYASVAKLRPWIDAKL 394
            .|:.|||.:|:..|.||..|:
  Fly   255 ANVAGVYTNVSYHREWIFNKM 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 72/251 (29%)
Tryp_SPc 153..390 CDD:214473 71/250 (28%)
CG30289NP_726081.1 Tryp_SPc 42..271 CDD:214473 74/261 (28%)
Tryp_SPc 42..271 CDD:238113 74/261 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.