DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5390 and CG30288

DIOPT Version :9

Sequence 1:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_001097398.1 Gene:CG30288 / 246531 FlyBaseID:FBgn0050288 Length:282 Species:Drosophila melanogaster


Alignment Length:283 Identity:82/283 - (28%)
Similarity:124/283 - (43%) Gaps:70/283 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 CGYQNPNGVGFKITGAVNQEAEFGEFPWMLAILREEGNLNLYECGGALIAPNVVLTAAHCVHNKQ 199
            ||..:.||...:|.|  .::|.....|||:.::.....:    |||:||....||||.||:   .
  Fly    31 CGTTSSNGYRARIDG--GRDAGMESNPWMVRVMISGKAV----CGGSLITARFVLTAEHCI---S 86

  Fly   200 PSSIVVRAGEWDTQTQTEIRRHE----DRYV-----------KEIIYHEQFNKGSLYNDVAVMLL 249
            |..:.||.||:||       ||.    |.:|           ::|::.   |.|   .|:.::.:
  Fly    87 PMYMNVRLGEYDT-------RHPIFDCDDFVCTPRAYNVDVDRKIVHS---NPG---YDIGLLRM 138

  Fly   250 ESPFTLQENIQTVCL---PNVGD------KFDFDRCYATGWGKNKFGKDGEYQVILKKVDMPVVP 305
            :........::.:||   ..:|.      :|:|     ||||.|   .|||.|..|:...:..:|
  Fly   139 QRSVIFSNYVRPICLILGKTLGGNPLSILRFNF-----TGWGTN---SDGEEQDRLQTATLQQLP 195

  Fly   306 EQQCETNLRETRLGRHFILHDSFICAGGEKDKDTCKGDGGSPL--VCPIAGQKNRFKSAGIVAWG 368
            :..||      |.||.  |..|:||| |....|:||||.|.||  :....||...|: .|:.:.|
  Fly   196 QWSCE------RPGRP--LDISYICA-GSYISDSCKGDSGGPLSAIRTFEGQGRVFQ-FGVASQG 250

  Fly   369 IG-CGEVNIPGVYASVAKLRPWI 390
            :. |..:   |:|.:|.....||
  Fly   251 LRLCSGL---GIYTNVTHFTDWI 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 76/265 (29%)
Tryp_SPc 153..390 CDD:214473 74/263 (28%)
CG30288NP_001097398.1 Tryp_SPc 42..270 CDD:214473 76/270 (28%)
Tryp_SPc 45..270 CDD:238113 75/267 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.