DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5390 and CG30083

DIOPT Version :9

Sequence 1:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_725492.3 Gene:CG30083 / 246444 FlyBaseID:FBgn0050083 Length:279 Species:Drosophila melanogaster


Alignment Length:272 Identity:79/272 - (29%)
Similarity:119/272 - (43%) Gaps:57/272 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 CGYQNPNGVGFKITGAVNQEAEFGEFPWMLAILR-EEGNLNLYECGGALIAPNVVLTAAHCVHNK 198
            |||.:   :..||..  .|.||.|..|||..|.: .:..:....|||.||....||:||||:  |
  Fly    25 CGYPD---ISPKIMH--GQNAENGTNPWMAYIFKYNDKEVAELVCGGTLIHKQFVLSAAHCI--K 82

  Fly   199 QPSSIVVRAGEWDTQTQTEIRRHEDRY--VKEIIYHEQFNKGSLYNDVAVMLLESPFTLQENIQT 261
            :...:.||.||          ....||  |.:...::.|..||..||:.::.::........|:.
  Fly    83 RDQILAVRLGE----------HSSSRYFAVTKAFRNKYFTTGSYSNDIGILRIQPIVKFNAVIRP 137

  Fly   262 VCL-------PNVGDKFDFDRCYATGWGKNKFGKDGEYQVILKKVDMPVVPEQQCE----TNLRE 315
            :|:       |||      ....|.||||.   ::..:..:||.|::..:...:|.    .|:.|
  Fly   138 ICIITDPTKVPNV------KTFKAAGWGKT---ENETFSKVLKTVELNELNASECYNMLWVNVTE 193

  Fly   316 TRLGRHFILHDSFICAGGEKDKDTCKGDGGSPLVCPIAGQKN-RFKSAGIVAWGIG-CGEVNIPG 378
            ::           ||| |..|.|||.||.|.||:.|:....: |:...||:::|.. |   |.||
  Fly   194 SQ-----------ICA-GHPDGDTCAGDSGGPLIHPVYMDGSLRYVQLGIISFGSSLC---NSPG 243

  Fly   379 VYASVAKLRPWI 390
            ||..::....||
  Fly   244 VYTRLSSFIDWI 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 74/254 (29%)
Tryp_SPc 153..390 CDD:214473 72/252 (29%)
CG30083NP_725492.3 Tryp_SPc 33..255 CDD:214473 74/259 (29%)
Tryp_SPc 34..255 CDD:238113 73/258 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.