DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5390 and Mst1

DIOPT Version :9

Sequence 1:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster
Sequence 2:XP_038936729.1 Gene:Mst1 / 24566 RGDID:3114 Length:747 Species:Rattus norvegicus


Alignment Length:392 Identity:83/392 - (21%)
Similarity:135/392 - (34%) Gaps:92/392 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 VNPKDSSGSTGSENGGSSS-----TQYQSCGDQKECVPRW---------LCANDTINTSGDGIID 97
            |.|:.....:|.:..||.|     .|.|....:....|::         |.||...|..||....
  Rat   405 VVPEGCYHGSGEQYRGSVSKTRKGVQCQHWSSETPHKPQFTPTSAPHAGLEANFCRNPDGDSHGP 469

  Fly    98 IRLGTDAECKNYLDLCC------DLPNKRKDPIFEFKPDHPEGCGYQNPNGVGFKITGAVNQEAE 156
            .....|.|  ...|.|.      |.|....||..:.:   .|.||.:.......::.|     ..
  Rat   470 WCYTLDPE--TLFDYCALKRCDDDQPPSILDPPVQVQ---FEKCGKRVDQSNRLRVVG-----GH 524

  Fly   157 FGEFPWMLAILREEGNLNLYECGGALIAPNVVLTAAHCV------------------HNKQPSSI 203
            .|..||.:::...:|.   :.|||:|:....||||..|:                  .|.||   
  Rat   525 PGNSPWTVSLRNRQGQ---HFCGGSLVKEQWVLTARQCIWSCHDPLTGYEVWLGTINQNPQP--- 583

  Fly   204 VVRAGEWDTQTQTEIRRHEDRYVKEIIYHEQFNKGSLYNDVAVMLLESPFTLQENIQTVCLPNVG 268
                ||.:.|..:        ..|.:.       |...:.:.::.||.|..|..::..:|||  .
  Rat   584 ----GEANLQRVS--------VAKTVC-------GPAGSQLVLLKLERPVILNHHVARICLP--P 627

  Fly   269 DKF---DFDRCYATGWGKNKFGKDGEYQVILKKVDMPVVPEQQCETNLRETRLGRHFILHDSFIC 330
            :::   ....|...|||::|...:   ..:|....|.|:..|:|....|..       :.:|.||
  Rat   628 EQYVVPPGTNCEIAGWGESKGTSN---STVLHVAKMKVISSQECNVKYRRR-------VQESEIC 682

  Fly   331 AGG-EKDKDTCKGDGGSPLVCPIAGQKNRFKSAGIVAWGIGCGEVNIPGVYASVAKLRPWIDAKL 394
            ..| ......|:||.|.||.|   ...:.:...|::.....|.....|.::..|:....||:..:
  Rat   683 TEGLLAPTGACEGDYGGPLAC---YTHDCWVLQGLIIPNRVCARPRWPAIFTRVSVFVDWINKVV 744

  Fly   395 KI 396
            ::
  Rat   745 QL 746

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 55/259 (21%)
Tryp_SPc 153..390 CDD:214473 54/258 (21%)
Mst1XP_038936729.1 PAN_1 32..111 CDD:394981
KR 116..196 CDD:214527
KR 199..276 CDD:214527
KR 321..403 CDD:214527
KR 408..490 CDD:214527 17/83 (20%)
Tryp_SPc 520..743 CDD:238113 57/267 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.