DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5390 and Klk7

DIOPT Version :9

Sequence 1:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_036002.1 Gene:Klk7 / 23993 MGIID:1346336 Length:249 Species:Mus musculus


Alignment Length:249 Identity:68/249 - (27%)
Similarity:111/249 - (44%) Gaps:48/249 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   158 GEFPWMLAILREEGNLNLYECGGALIAPNVVLTAAHCVHNKQPSSIVVRAGEWDTQTQTEIRRHE 222
            |..||.:|:|:.    |...|||.|:....|||||||           :.|::..|..::  :..
Mouse    35 GSHPWQVALLKG----NQLHCGGVLVDKYWVLTAAHC-----------KMGQYQVQLGSD--KIG 82

  Fly   223 DRYVKEI-----IYHEQFNKGSLYNDVAVMLLESPFTLQENIQTVCLPN----VGDKFDFDRCYA 278
            |:..::|     ..|..::..:..||:.::.|:.|..:...::.|.||.    .|..     |..
Mouse    83 DQSAQKIKATKSFRHPGYSTKTHVNDIMLVRLDEPVKMSSKVEAVQLPEHCEPPGTS-----CTV 142

  Fly   279 TGWGKNKFGKDGEYQVILKKVDMPVVPEQQCETNLRETRLGRHFILHDSFICAGGEKDK-DTCKG 342
            :|||... ..|..:...|...|:.::..::|:...::       :|..:.:|||....| :||.|
Mouse   143 SGWGTTT-SPDVTFPSDLMCSDVKLISSRECKKVYKD-------LLGKTMLCAGIPDSKTNTCNG 199

  Fly   343 DGGSPLVCPIAGQKNRFKSAGIVAWG-IGCGEVNIPGVYASVAKLRPWIDAKLK 395
            |.|.||||....|       |:|:|| ..||:.|.||||..|.|.:.|:...:|
Mouse   200 DSGGPLVCNDTLQ-------GLVSWGTYPCGQPNDPGVYTQVCKYKRWVMETMK 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 67/243 (28%)
Tryp_SPc 153..390 CDD:214473 66/242 (27%)
Klk7NP_036002.1 Tryp_SPc 25..241 CDD:214473 66/242 (27%)
Serine protease. /evidence=ECO:0000250 26..246 67/247 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.