DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5390 and Prss42

DIOPT Version :9

Sequence 1:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_694739.1 Gene:Prss42 / 235628 MGIID:2665280 Length:335 Species:Mus musculus


Alignment Length:266 Identity:80/266 - (30%)
Similarity:130/266 - (48%) Gaps:50/266 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 KITGAVNQEAEFGEFPWMLAI-LREEGNLNLYECGGALIAPNVVLTAAHCVHN------------ 197
            ||.|.|  :||.|::||.::: :|     :::.|||:||....|||||||:::            
Mouse    78 KIMGGV--DAEEGKWPWQVSVRVR-----HMHVCGGSLINSQWVLTAAHCIYSRIQYNVKVGDRS 135

  Fly   198 --KQPSSIVVRAGEWDTQTQTEIRRHEDRYVKEIIYHEQFNKGSLY-NDVAVMLLESPFTLQENI 259
              :|.:|:|:.                   :|.|..|.:|:...:. ||:|::.|:.|.....||
Mouse   136 VYRQNTSLVIP-------------------IKTIFVHPKFSTTIVVKNDIALLKLQHPVNFTTNI 181

  Fly   260 QTVCLPNVGDKFDF---DRCYATGWGKNKFGKDGEYQVILKKVDMPVVPEQQCETNLRETRLGRH 321
            ..||:|:  :.|..   .:|:.|||||...|.......||::||..|:..::|...|::......
Mouse   182 YPVCIPS--ESFPVKAGTKCWVTGWGKLVPGAPDVPTEILQEVDQNVILYEECNEMLKKATSSSV 244

  Fly   322 FILHDSFICAGGEKDKDTCKGDGGSPLVCPIAGQKNRFKSAGIVAWGIGCGEVNIPGVYASVAKL 386
            .::....:|...|:.||.|:||.|.|:.|..   :|::...|:|:|||.||....||||..||..
Mouse   245 DLVKRGMVCGYKERGKDACQGDSGGPMSCEF---ENKWVQVGVVSWGISCGRKGYPGVYTDVAFY 306

  Fly   387 RPWIDA 392
            ..|:.|
Mouse   307 SKWLIA 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 75/256 (29%)
Tryp_SPc 153..390 CDD:214473 74/255 (29%)
Prss42NP_694739.1 Tryp_SPc 78..309 CDD:214473 78/261 (30%)
Tryp_SPc 79..310 CDD:238113 77/261 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8716
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.