DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5390 and TPSD1

DIOPT Version :9

Sequence 1:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_036349.1 Gene:TPSD1 / 23430 HGNCID:14118 Length:242 Species:Homo sapiens


Alignment Length:224 Identity:80/224 - (35%)
Similarity:110/224 - (49%) Gaps:23/224 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 GVGFKITGAV-NQEAEFGEFPWMLAILREEGNLNLYECGGALIAPNVVLTAAHCVHN--KQPSSI 203
            |...:.||.| .|||...::||.:: ||..|...::.|||:||.|..||||||||..  |..:::
Human    30 GQALQQTGIVGGQEAPRSKWPWQVS-LRVRGPYWMHFCGGSLIHPQWVLTAAHCVEPDIKDLAAL 93

  Fly   204 VVRAGEWDTQTQTEIRRHEDRYVKEIIYHEQFNKGSLYNDVAVMLLESPFTLQENIQTVCLPNVG 268
            .|:..|.....|.::..     |..||.|.||.......|:|::.||.|..:..:|.||.||...
Human    94 RVQLREQHLYYQDQLLP-----VSRIIVHPQFYIIQTGADIALLELEEPVNISSHIHTVTLPPAS 153

  Fly   269 DKFDFDR-CYATGWG--KNKFGKDGEYQVILKKVDMPVVPEQQCETNLRETRLGRHF-----ILH 325
            :.|.... |:.||||  .|.......|.  ||:|::|||....|..   |...|.|.     |:.
Human   154 ETFPPGMPCWVTGWGDVDNNVHLPPPYP--LKEVEVPVVENHLCNA---EYHTGLHTGHSFQIVR 213

  Fly   326 DSFICAGGEKDKDTCKGDGGSPLVCPIAG 354
            |..:|||.| :.|:|:||.|.||||.:.|
Human   214 DDMLCAGSE-NHDSCQGDSGGPLVCKVNG 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 76/212 (36%)
Tryp_SPc 153..390 CDD:214473 76/212 (36%)
TPSD1NP_036349.1 Tryp_SPc 38..242 CDD:238113 77/216 (36%)
Tryp_SPc 38..240 CDD:214473 76/213 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152802
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.