DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5390 and Prss40

DIOPT Version :9

Sequence 1:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_033382.2 Gene:Prss40 / 21756 MGIID:1270857 Length:365 Species:Mus musculus


Alignment Length:285 Identity:83/285 - (29%)
Similarity:119/285 - (41%) Gaps:61/285 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 EGCGYQNPNGVGFKITGAVNQEAEFGEFPWMLAILREEGNLNLYE---CGGALIAPNVVLTAAHC 194
            |.||.....|   ||.|.....||  .:||       :.:|.||.   ||..||..|.||:||||
Mouse    58 EVCGKTKFQG---KIYGGQIAGAE--RWPW-------QASLRLYGRHICGAVLIDKNWVLSAAHC 110

  Fly   195 VHNKQ-PSSIVVRAGEWDTQTQTEIRRHEDRYVKEIIYHEQFNK----GSLYNDVAVMLLESPFT 254
            ....| ||...|..|..|..:.|...|  ...|:::|.|:.:|:    ||   |:.::.|.|...
Mouse   111 FQRSQEPSDYHVMLGYTDLNSPTRYSR--TMSVQKVIVHKDYNRFHTQGS---DIVLLQLRSSVE 170

  Fly   255 LQENIQTVCLPNVGDKFDFDR-CYATGWG----------KNKFGKDGEYQVILKKVDM------P 302
            ...:|...|:|....|...:: |:|:|||          .|:.   .|.::|:...|.      |
Mouse   171 YSSHILPACVPEENIKIPKEKACWASGWGYLREDVRIPLPNEL---YEAELIIMSNDQCKGFFPP 232

  Fly   303 VVPEQQCETNLRETRLGRHFILHDSFICAGG-EKDKDTCKGDGGSPLVCPIAGQKNRFKSAGIVA 366
            .||..           ||.:.::|..:||.. :..|..|.||.|.||||.:.|.   :...|:.:
Mouse   233 PVPGS-----------GRSYYIYDDMVCAADYDMSKSICAGDSGGPLVCLLEGS---WYVVGLTS 283

  Fly   367 WGIGCGE-VNIPGVYASVAKLRPWI 390
            |...|.| :..|.|:|.|:....||
Mouse   284 WSSTCEEPIVSPSVFARVSYFDKWI 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 76/265 (29%)
Tryp_SPc 153..390 CDD:214473 74/263 (28%)
Prss40NP_033382.2 Tryp_SPc 68..308 CDD:214473 77/270 (29%)
Tryp_SPc 69..311 CDD:238113 78/271 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 312..343
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.