DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5390 and Prss39

DIOPT Version :9

Sequence 1:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_033381.1 Gene:Prss39 / 21755 MGIID:1270856 Length:367 Species:Mus musculus


Alignment Length:269 Identity:71/269 - (26%)
Similarity:117/269 - (43%) Gaps:23/269 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 EGCGYQNPNGVGFKITGAVNQEAEFGEFPWMLAILREEGNLNLYECGGALIAPNVVLTAAHCVHN 197
            |.||.....|   ||.|....:||  .:||..:::....::    ||..||....:|:||||...
Mouse    57 ELCGKTKFQG---KIYGGQIAKAE--RWPWQASLIFRGRHI----CGAVLIDKTWLLSAAHCFQR 112

  Fly   198 K-QPSSIVVRAGEWDTQTQTEIRRHEDRYVKEIIYHEQFNKGS-LYNDVAVMLLESPFTLQENIQ 260
            . .||...:..|.  .|............|.::|.||.::|.| |..::.::.|..|.....:|.
Mouse   113 SLTPSDYRILLGY--NQLSNPSNYSRQMTVNKVILHEDYSKLSRLEKNIVLIQLHHPVIYSTHIF 175

  Fly   261 TVCLPNVGDKFDFDR-CYATGWGKNKFGKDGEYQVILKKVDMPVVPEQQCETNLR--ETRLGRHF 322
            ..|:|:...|...:. |:.:|||.....|..:....|...::.::.|::|.|..:  |..:..:.
Mouse   176 PACVPDGTTKVSPNNLCWISGWGMLSADKFLQAPFPLLDAEVSLIDEEECTTFFQTPEVSITEYD 240

  Fly   323 ILHDSFICAGG-EKDKDTCKGDGGSPLVCPIAGQKNRF-KSAGIVAWGIGCGE-VNIPGVYASVA 384
            ::.|..:|||. ...|.:|:||.|.||||.:    |.| ...|:..|...|.| ::.|.::..|:
Mouse   241 VIKDDVLCAGDLTNQKSSCRGDSGGPLVCFL----NSFWYVVGLANWNGACLEPIHSPNIFTKVS 301

  Fly   385 KLRPWIDAK 393
            ....||..|
Mouse   302 YFSDWIKQK 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 62/245 (25%)
Tryp_SPc 153..390 CDD:214473 61/244 (25%)
Prss39NP_033381.1 Tryp_SPc 67..307 CDD:214473 64/251 (25%)
Tryp_SPc 68..310 CDD:238113 65/253 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.