DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5390 and Prss27

DIOPT Version :9

Sequence 1:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_780649.1 Gene:Prss27 / 213171 MGIID:2450123 Length:328 Species:Mus musculus


Alignment Length:262 Identity:87/262 - (33%)
Similarity:123/262 - (46%) Gaps:21/262 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 CGYQNPNGVGFKITGAVNQEAEFGEFPWMLAILREEGNLNLYECGGALIAPNVVLTAAHCVHNKQ 199
            ||:  |......:.|   :.|..||:||.::|.|.    .::.|||:||||..|||||||..|..
Mouse    29 CGH--PKMFNRMVGG---ENALEGEWPWQVSIQRN----GIHFCGGSLIAPTWVLTAAHCFSNTS 84

  Fly   200 PSSIV-VRAGEWDTQTQTEIRRHEDRYVKEIIYHEQFNKGSLYNDVAVMLLESPFTLQENIQTVC 263
            ..||. |..|....|.......:..  ||::..:.|:...:...|||::.|:.|.|....|..||
Mouse    85 DISIYQVLLGALKLQQPGPHALYVP--VKQVKSNPQYQGMASSADVALVELQGPVTFTNYILPVC 147

  Fly   264 LPNVGDKFDFD-RCYATGWGKNKFGKDGEYQVILKKVDMPVVPEQQCETNLRETRLGRHF---IL 324
            ||:....|:.. .|:.||||............:|:|:.:|::...:|.. |....:...|   .:
Mouse   148 LPDPSVIFESGMNCWVTGWGSPSEQDRLPNPRVLQKLAVPIIDTPKCNL-LYNKDVESDFQLKTI 211

  Fly   325 HDSFICAG-GEKDKDTCKGDGGSPLVCPIAGQKNRFKSAGIVAWGIGCGEVNIPGVYASVAKLRP 388
            .|..:||| .|..||.||||.|.||||.:   ...:..||:::||.||...|.||||..|.....
Mouse   212 KDDMLCAGFAEGKKDACKGDSGGPLVCLV---DQSWVQAGVISWGEGCARRNRPGVYIRVTSHHK 273

  Fly   389 WI 390
            ||
Mouse   274 WI 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 83/244 (34%)
Tryp_SPc 153..390 CDD:214473 81/242 (33%)
Prss27NP_780649.1 Tryp_SPc 37..275 CDD:214473 82/250 (33%)
Tryp_SPc 39..278 CDD:238113 84/250 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8716
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.