DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5390 and Proc

DIOPT Version :9

Sequence 1:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster
Sequence 2:XP_006525784.1 Gene:Proc / 19123 MGIID:97771 Length:484 Species:Mus musculus


Alignment Length:357 Identity:104/357 - (29%)
Similarity:155/357 - (43%) Gaps:81/357 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 NGGSSSTQY---QSCGDQKECVPRWLCANDTINTSGDGIIDIRLGTDAECKNYLDLCCD-----L 116
            |||  ...|   :|.|.:..|.|.:..|:|.:                .||:.::..|.     :
Mouse   167 NGG--CLHYCLEESNGRRCACAPGYELADDHM----------------RCKSTVNFPCGKLGRWI 213

  Fly   117 PNKRK------DPIFEFKPDHPEGCGYQNPNGVGFKITGAVNQEAEFGEFPWMLAILREEGNLNL 175
            ..|||      |...|.:||         |..|...:|       :.|:.||...:|..:..|  
Mouse   214 EKKRKILKRDTDLEDELEPD---------PRIVNGTLT-------KQGDSPWQAILLDSKKKL-- 260

  Fly   176 YECGGALIAPNVVLTAAHCVHNKQPSSIVVRAGEWDTQTQTEIRRHE----DRYVKEIIYHEQFN 236
             .|||.||..:.||||||||...:  .:.||.||:|      :||.:    |..:|||:.|..:.
Mouse   261 -ACGGVLIHTSWVLTAAHCVEGTK--KLTVRLGEYD------LRRRDHWELDLDIKEILVHPNYT 316

  Fly   237 KGSLYNDVAVMLLESPFTLQENIQTVCLPNVGDKFDFDRC----YATGWG-KNKFGKDGEYQ--V 294
            :.|..||:|::.|..|.||.:.|..:||||.|...:..:.    ..|||| ::...|||...  .
Mouse   317 RSSSDNDIALLRLAQPATLSKTIVPICLPNNGLAQELTQAGQETVVTGWGYQSDRIKDGRRNRTF 381

  Fly   295 ILKKVDMPVVPEQQCETNLRETRLGRHFILHDSFICAGGEKD-KDTCKGDGGSPLVCPIAGQKNR 358
            ||..:.:|:|...:|...::.       ::.::.:|||...| :|.|.||.|.|:|....|   .
Mouse   382 ILTFIRIPLVARNECVEVMKN-------VVSENMLCAGIIGDTRDACDGDSGGPMVVFFRG---T 436

  Fly   359 FKSAGIVAWGIGCGEVNIPGVYASVAKLRPWI 390
            :...|:|:||.|||..|..|:|..|.....||
Mouse   437 WFLVGLVSWGEGCGHTNNYGIYTKVGSYLKWI 468

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 81/250 (32%)
Tryp_SPc 153..390 CDD:214473 79/248 (32%)
ProcXP_006525784.1 GLA 50..110 CDD:214503
EGF_CA 111..155 CDD:238011
FXa_inhibition 163..198 CDD:373209 10/48 (21%)
Tryp_SPc 236..470 CDD:238113 83/261 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.