DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5390 and F25E5.3

DIOPT Version :9

Sequence 1:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_504915.1 Gene:F25E5.3 / 184925 WormBaseID:WBGene00017784 Length:377 Species:Caenorhabditis elegans


Alignment Length:241 Identity:46/241 - (19%)
Similarity:77/241 - (31%) Gaps:70/241 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   159 EFPWMLAILREEGNLNLYE-CGGALIAPNVVL----------TAAHCVHNKQPSSIVVRAGEWDT 212
            |.||       .|::|:|. ....:|:|..:|          |....:.|:   :::.:..:.|.
 Worm    58 ESPW-------AGSVNIYGILSSTVISPRHILLFNLIQLNVDTLKMSILNE---TVIAQESKCDK 112

  Fly   213 QT-----------QTE-IRRHED---RYVKEIIYHEQFNKGSLYNDVAVMLLESPFTLQENIQTV 262
            ..           |.: :.:..|   ::|:.|...:..::...|..: ::.||......:.....
 Worm   113 SDLLLPHQINDWFQVDFVAKQMDKAYKHVQRIYTIDGCDELDTYKPM-IIELEYDMWFDKAHGAA 176

  Fly   263 CLPNVGDKFDFDRCYATGWGKNKFGKDGEYQVILKKVDMPVVPEQQCETNLRETRLGRHFILHD- 326
            |||......|.......|.|.|                         ||.|..||..:.....: 
 Worm   177 CLPKPISHSDIQEFTVFGLGPN-------------------------ETALTSTRYAKEACEREH 216

  Fly   327 ---SFICAGGEK-DKDTCKGDGGSPLVCPIAGQKNRFKSAGIVAWG 368
               |..|....| ::..|.||.|:..|..|.|   |....||.|.|
 Worm   217 AGNSVFCGRPLKGNRRLCAGDFGAGAVATIDG---RNVVLGIYAEG 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 46/241 (19%)
Tryp_SPc 153..390 CDD:214473 46/241 (19%)
F25E5.3NP_504915.1 DUF316 7..292 CDD:252150 46/241 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.