DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5390 and Tpsb2

DIOPT Version :9

Sequence 1:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_034911.3 Gene:Tpsb2 / 17229 MGIID:96942 Length:276 Species:Mus musculus


Alignment Length:264 Identity:83/264 - (31%)
Similarity:127/264 - (48%) Gaps:25/264 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 YQNPNGVGFKITGAVNQEAEFGEFPWMLAILREEGNLNLYECGGALIAPNVVLTAAHCV--HNKQ 199
            |..|.....::......||...::||.:: ||.:.|..::.|||:||.|..||||||||  |.|.
Mouse    20 YSAPRPANQRVGIVGGHEASESKWPWQVS-LRFKLNYWIHFCGGSLIHPQWVLTAAHCVGPHIKS 83

  Fly   200 PSSIVVRAGEWDTQTQTEIRRHEDRY--VKEIIYHEQFNKGSLYNDVAVMLLESPFTLQENIQTV 262
            |....|       |.:.:...:.|:.  :..|:.|..:.......|||::.||.|..:..::..:
Mouse    84 PQLFRV-------QLREQYLYYGDQLLSLNRIVVHPHYYTAEGGADVALLELEVPVNVSTHLHPI 141

  Fly   263 CLPNVGDKF-DFDRCYATGWGKNKFGKDGEYQVILKKVDMPVVPEQQCETNLRETRLGRHF---- 322
            .||...:.| ....|:.||||.....:.......||:|.:|:|....|:   |:...|.:.    
Mouse   142 SLPPASETFPPGTSCWVTGWGDIDNDEPLPPPYPLKQVKVPIVENSLCD---RKYHTGLYTGDDF 203

  Fly   323 -ILHDSFICAGGEKDKDTCKGDGGSPLVCPIAGQKNRFKSAGIVAWGIGCGEVNIPGVYASVAKL 386
             |:||..:|||..: :|:|:||.|.||||.:   |..:..||:|:||.||.:.|.||:|..|...
Mouse   204 PIVHDGMLCAGNTR-RDSCQGDSGGPLVCKV---KGTWLQAGVVSWGEGCAQPNKPGIYTRVTYY 264

  Fly   387 RPWI 390
            ..||
Mouse   265 LDWI 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 81/248 (33%)
Tryp_SPc 153..390 CDD:214473 79/246 (32%)
Tpsb2NP_034911.3 Tryp_SPc 32..270 CDD:238113 81/252 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842852
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8716
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.